CD116/CSF2RA recombinant protein

CD116/CSF2RA Recombinant Protein

Cat. Num. AAA3003838

• Gene Names: CSF2RA; GMR; CD116; CSF2R; SMDP4; CDw116; CSF2RX; CSF2RY; GMCSFR; CSF2RAX; CSF2RAY; GM-CSF-R-alpha
• Purity: Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is >85% (by SDS-PAGE).
• Synonyms: CD116/CSF2RA; CD116/CSF2RA Recombinant Protein; CD116/CSF2RA recombinant protein

• Host: E Coli
• Purity/Purification: Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is >85% (by SDS-PAGE).
• Form/Format: PBS, 4M Urea, PH7.4
• Concentration: >=0.5mg/ml (varies by lot)
• Sequence: EKSDLRTVAPASSLNVRFDSRTMNLSWDCQENTTFSKCFLTDKKNRVVEPRLSNNECSCTFREICLHEGVTFEVHVNTSQRGFQQKLLYPNSGREGTAAQNFSCFIYNADLMNCTWARGPTAPRDVQYFLYIRNSKRRREIRCPYYIQDSGTHVGCHLDNLSGLTSRNYFLVNGTSREIGIQFFDSLLDTKKIERFNPPSNVTVRCNTTHCLVRWKQPRTYQKLSYLDFQYQLDVHRKNTQPGTENLLINVSGDLENRYNFPSSEPRAKHSVKIRAADVRILNWSSWSEAIEFGSDDG

• Tag: His-tag in C-terminal
• Expression Vector: pet-22b(+)
• BP: 906
• Restriction Site: NdeI-XhoI
• Preparation and Storage: Store at 4 degee C for short term. Aliquot and store at -20 degee C long term. Avoid freeze-thaw cycles.

Testing Data

()

Related Product Information for CD116/CSF2RA recombinant protein

Background: Granulocyte-macrophage colony-stimulating factor receptor subunit alpha (GM-CSF Receptor alpha), also known as CSF2RA and CD116, is a type 1 transmembrane protein with low affinity for GM-CSF. GM-CSF Receptor alpha is primarily expressed on myeloid cells, including granulocytes, monocytes, macrophages, and dendritic cells. GM-CSF Receptor alpha forms a heterodimeric receptor complex with GM-CSF Receptor beta, creating the high affinity GM-CSF receptor. Upon dimerization and ligand binding, the beta subunit becomes phosphorylated and transduces signals via Jak/STAT and MAPK pathways for cell proliferation, differentiation, and survival. Oligomerization of the high affinity GM-CSF Receptor alpha/beta complex is required for optimal intracellular signal transduction. Soluble GM-CSF Receptor alpha, either secreted or cleaved from the cell surface, can competitively bind GM-CSF, preventing membrane receptor signaling. Multiple isoforms of GM-CSF Receptor alpha have been described.

NCBI and Uniprot Product Information

• NCBI GI #: 238908515
• NCBI GeneID: 1438
• NCBI Accession #: NP_001155001.1
• NCBI GenBank Nucleotide #: NM_001161529.1
• UniProt Accession #: P15509; O00207; Q14429; Q14430; Q14431; Q16564; A7J003; A8KAM1; B4DW68; J3JS76
• Molecular Weight: 46,207 Da
• NCBI Official Full Name: granulocyte-macrophage colony-stimulating factor receptor subunit alpha isoform a
• NCBI Official Synonym Full Names: colony stimulating factor 2 receptor, alpha, low-affinity (granulocyte-macrophage)
• NCBI Official Symbol: CSF2RA
• NCBI Official Synonym Symbols: GMR; CD116; CSF2R; SMDP4; CDw116; CSF2RX; CSF2RY; GMCSFR; CSF2RAX; CSF2RAY; GM-CSF-R-alpha
• NCBI Protein Information: granulocyte-macrophage colony-stimulating factor receptor subunit alpha; GMR-alpha; GMCSFR-alpha; CD116 antigen; GM-CSF receptor alpha subunit; colony stimulating factor 2 receptor alpha subunit; granulocyte-macrophage colony-stimulating factor receptor a
• UniProt Protein Name: Granulocyte-macrophage colony-stimulating factor receptor subunit alpha
• UniProt Gene Name: CSF2RA
• UniProt Synonym Gene Names: CSF2R; CSF2RY; GM-CSF-R-alpha; GMCSFR-alpha; GMR-alpha
• UniProt Entry Name: CSF2R_HUMAN

NCBI Description

The protein encoded by this gene is the alpha subunit of the heterodimeric receptor for colony stimulating factor 2, a cytokine which controls the production, differentiation, and function of granulocytes and macrophages. The encoded protein is a member of the cytokine family of receptors. This gene is found in the pseudoautosomal region (PAR) of the X and Y chromosomes. Multiple transcript variants encoding different isoforms have been found for this gene, with some of the isoforms being membrane-bound and others being soluble. [provided by RefSeq, Jul 2008]

Uniprot Description

CSF2RA: Low affinity receptor for granulocyte-macrophage colony- stimulating factor. Transduces a signal that results in the proliferation, differentiation, and functional activation of hematopoietic cells. Defects in CSF2RA are the cause of pulmonary surfactant metabolism dysfunction type 4 (SMDP4). A rare lung disorder due to impaired surfactant homeostasis. It is characterized by alveolar filling with floccular material that stains positive using the periodic acid-Schiff method and is derived from surfactant phospholipids and protein components. Excessive lipoproteins accumulation in the alveoli results in severe respiratory distress. Belongs to the type I cytokine receptor family. Type 5 subfamily. 8 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral; Receptor, cytokine

Chromosomal Location of Human Ortholog: Xp22.32 and Yp11.3

Cellular Component: integral to plasma membrane; extracellular region; plasma membrane

Molecular Function: hematopoietin/interferon-class (D200-domain) cytokine receptor activity; receptor activity

Biological Process: response to ethanol; cytokine and chemokine mediated signaling pathway

Disease: Surfactant Metabolism Dysfunction, Pulmonary, 4