Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Amyloid beta A4 Protein | APP protein

Amyloid beta A4 protein

Gene Names
APP; AAA; AD1; PN2; ABPP; APPI; CVAP; ABETA; PN-II; preA4; CTFgamma
Applications
ELISA, Western Blot
Purity
>95% by SDS-PAGE
Synonyms
Amyloid beta A4; Amyloid beta A4 protein; A4; AD1; ABPP; APPI; Alzheimer disease amyloid protein; Amyloid precursor protein; Beta-amyloid precursor protein; Cerebral vascular amyloid peptide; PreA4; Protease nexin-II; APP; CVAP; PN-II; APP protein
Ordering
Host
E Coli
Purity/Purification
>95% by SDS-PAGE
Form/Format
Liquid
Sequence
CNAQFRHNSGYQVHHQKLVFFAQNVGSNKGAIIGLMVGGVV
Sequence Length
770
Applicable Applications for APP protein
ELISA (EIA), Western Blot (WB), Affinity Purification (AP), Protein Array
Tags
His
Storage Buffer
50mM NaH2PO4, 500mM NaCl Buffer with 500mM Imidazole,10%glycerol(PH8.0)
Preparation and Storage
Store at -20 degree C.
Avoid repeated freezing and thawing.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
351
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
84,521 Da
NCBI Official Full Name
amyloid-beta A4 protein isoform a
NCBI Official Synonym Full Names
amyloid beta precursor protein
NCBI Official Symbol
APP
NCBI Official Synonym Symbols
AAA; AD1; PN2; ABPP; APPI; CVAP; ABETA; PN-II; preA4; CTFgamma
NCBI Protein Information
amyloid-beta A4 protein
UniProt Protein Name
Amyloid-beta A4 protein
Protein Family
UniProt Gene Name
APP
UniProt Synonym Gene Names
A4; AD1; APP; CVAP; PN-II; S-APP-alpha; S-APP-beta; Beta-CTF; Abeta42; Abeta40; Alpha-CTF; AICD-59; AID(59); AICD-57; AID(57); AICD-50; AID(50)

NCBI Description

This gene encodes a cell surface receptor and transmembrane precursor protein that is cleaved by secretases to form a number of peptides. Some of these peptides are secreted and can bind to the acetyltransferase complex APBB1/TIP60 to promote transcriptional activation, while others form the protein basis of the amyloid plaques found in the brains of patients with Alzheimer disease. In addition, two of the peptides are antimicrobial peptides, having been shown to have bacteriocidal and antifungal activities. Mutations in this gene have been implicated in autosomal dominant Alzheimer disease and cerebroarterial amyloidosis (cerebral amyloid angiopathy). Multiple transcript variants encoding several different isoforms have been found for this gene. [provided by RefSeq, Aug 2014]

Uniprot Description

Functions as a cell surface receptor and performs physiological functions on the surface of neurons relevant to neurite growth, neuronal adhesion and axonogenesis. Involved in cell mobility and transcription regulation through protein-protein interactions. Can promote transcription activation through binding to APBB1-KAT5 and inhibits Notch signaling through interaction with Numb. Couples to apoptosis-inducing pathways such as those mediated by G(O) and JIP. Inhibits G(o) alpha ATPase activity (). Acts as a kinesin I membrane receptor, mediating the axonal transport of beta-secretase and presenilin 1. Involved in copper homeostasis/oxidative stress through copper ion reduction. In vitro, copper-metallated APP induces neuronal death directly or is potentiated through Cu2+-mediated low-density lipoprotein oxidation. Can regulate neurite outgrowth through binding to components of the extracellular matrix such as heparin and collagen I and IV. The splice isoforms that contain the BPTI domain possess protease inhibitor activity. Induces a AGER-dependent pathway that involves activation of p38 MAPK, resulting in internalization of amyloid-beta peptide and leading to mitochondrial dysfunction in cultured cortical neurons. Provides Cu2+ ions for GPC1 which are required for release of nitric oxide (NO) and subsequent degradation of the heparan sulfate chains on GPC1.

Research Articles on APP

Similar Products

Product Notes

The APP app (Catalog #AAA2888883) is a Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's Amyloid beta A4 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB), Affinity Purification (AP), Protein Array. Researchers should empirically determine the suitability of the APP app for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: CNAQFRHNSG YQVHHQKLVF FAQNVGSNKG AIIGLMVGGV V. It is sometimes possible for the material contained within the vial of "Amyloid beta A4, Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.