Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (TD) (SDS-PAGE)

Glypican 3 Recombinant Protein | GPC3 recombinant protein

Recombinant Human Glypican 3 (GPC3)

Gene Names
GPC3; SGB; DGSX; MXR7; SDYS; SGBS; OCI-5; SGBS1; GTR2-2
Applications
Western Blot, ELISA
Purity
> 90% as determined by SDS-PAGE.
Synonyms
Glypican 3; Recombinant Human Glypican 3 (GPC3); DGSX; OCI5; SDYS; SGB; SGBS1; MXR7; Glypican Proteoglycan 3; GTR2-2; Intestinal protein OCI-5; Secreted glypican-3.; GPC3 recombinant protein
Ordering
For Research Use Only!
Host
E. coli AA 121-220 (P51654).
Purity/Purification
> 90% as determined by SDS-PAGE.
Form/Format
0.15 M PBS, pH 7.5, with 50% glycerol
Concentration
1 mg/mL (varies by lot)
Sequence
HAKNYTNAMFKNNYPSLTPQAFEFVGEFFTDVSLYILGSDINVDDMVNELFDSLFPVIYTQLMNPGLPDSALDINECLRGARRDLKVFGNFPKLIMTQVS
Sequence Length
58
Applicable Applications for GPC3 recombinant protein
Western Blot (WB), ELISA (EIA)
Application Notes
Western blotting, ELISA, Albumin-bound fluorescence was used in serum of patients with chronic renal failure.
Source
Human
Protein Residues
with N-terminal 6×His-tag.
Predicted MW
30 kDa
Observed MW
30 kDa
Usage
GPC3 Protein - Centrifuge the standard vial at 6000-10000rpm for 30s.
Preparation and Storage
Store it under sterile conditions at -20°C upon receiving.
Recommend to aliquot the protein into smaller quantities for optimal storage.
**Avoid repeated freeze-thaw cycles.


The recombinant protein is stable for up to 6 months from date of receipt at -80°C.

Testing Data (TD)

(SDS-PAGE)

Testing Data (TD) (SDS-PAGE)
Related Product Information for GPC3 recombinant protein
Glypican 3, also known as GPC3, The protein encoded by this gene is a member of the glypican family.Glypican 3 immunostaining has utility for differentiating hepatocellular carcinoma (HCC) and dysplastic changes in cirrhotic livers; HCC stains with glypican 3, while liver with dysplastic changes and/or cirrhotic changes does not.

Cell surface heparan sulfate proteoglycans are composed of a membrane-associated protein core substituted with a variable number of heparan sulfate chains. Members of the glypican-related integral membrane proteoglycan family (GRIPS) contain a core protein anchored to the cytoplasmic membrane via a glycosyl phosphatidylinositol linkage. These proteins may play a role in the control of cell division and growth regulation.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Official Full Name
glypican 3, partial
NCBI Official Synonym Full Names
glypican 3
NCBI Official Symbol
GPC3
NCBI Official Synonym Symbols
SGB; DGSX; MXR7; SDYS; SGBS; OCI-5; SGBS1; GTR2-2
NCBI Protein Information
glypican-3; secreted glypican-3; glypican proteoglycan 3; intestinal protein OCI-5; heparan sulphate proteoglycan
UniProt Protein Name
Glypican-3
Protein Family
UniProt Gene Name
GPC3
UniProt Synonym Gene Names
OCI5
UniProt Entry Name
GPC3_HUMAN

NCBI Description

Cell surface heparan sulfate proteoglycans are composed of a membrane-associated protein core substituted with a variable number of heparan sulfate chains. Members of the glypican-related integral membrane proteoglycan family (GRIPS) contain a core protein anchored to the cytoplasmic membrane via a glycosyl phosphatidylinositol linkage. These proteins may play a role in the control of cell division and growth regulation. The protein encoded by this gene can bind to and inhibit the dipeptidyl peptidase activity of CD26, and it can induce apoptosis in certain cell types. Deletion mutations in this gene are associated with Simpson-Golabi-Behmel syndrome, also known as Simpson dysmorphia syndrome. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Sep 2009]

Uniprot Description

GPC3: Cell surface proteoglycan that bears heparan sulfate. Inhibits the dipeptidyl peptidase activity of DPP4. May be involved in the suppression/modulation of growth in the predominantly mesodermal tissues and organs. May play a role in the modulation of IGF2 interactions with its receptor and thereby modulate its function. May regulate growth and tumor predisposition. Defects in GPC3 are the cause of Simpson-Golabi-Behmel syndrome type 1 (SGBS1); also known as Simpson dysmorphia syndrome (SDYS). SGBS is a condition characterized by pre- and postnatal overgrowth (gigantism) with visceral and skeletal anomalies. Belongs to the glypican family.

Protein type: Membrane protein, GPI anchor; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: Xq26.1

Cellular Component: extracellular space; lysosomal lumen; proteinaceous extracellular matrix; anchored to plasma membrane; integral to plasma membrane; Golgi lumen; plasma membrane

Molecular Function: heparan sulfate proteoglycan binding; protein binding

Biological Process: phototransduction, visible light; anatomical structure morphogenesis; glycosaminoglycan metabolic process; negative regulation of peptidase activity; positive regulation of endocytosis; pathogenesis; osteoclast differentiation; embryonic hindlimb morphogenesis; bone mineralization; body morphogenesis; chondroitin sulfate metabolic process; positive regulation of glucose import; glycosaminoglycan biosynthetic process; glycosaminoglycan catabolic process; ureteric bud branching; negative regulation of smoothened signaling pathway; carbohydrate metabolic process; positive regulation of protein catabolic process; positive regulation of smoothened signaling pathway; retinoid metabolic process; positive regulation of BMP signaling pathway; negative regulation of epithelial cell proliferation; lung development; negative regulation of growth; anterior/posterior axis specification

Disease: Simpson-golabi-behmel Syndrome, Type 1; Wilms Tumor 1

Research Articles on GPC3

Similar Products

Product Notes

The GPC3 gpc3 (Catalog #AAA283677) is a Recombinant Protein produced from E. coli AA 121-220 (P51654). and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's Glypican 3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), ELISA (EIA). Western blotting, ELISA, Albumin-bound fluorescence was used in serum of patients with chronic renal failure. Researchers should empirically determine the suitability of the GPC3 gpc3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: HAKNYTNAMF KNNYPSLTPQ AFEFVGEFFT DVSLYILGSD INVDDMVNEL FDSLFPVIYT QLMNPGLPDS ALDINECLRG ARRDLKVFGN FPKLIMTQVS. It is sometimes possible for the material contained within the vial of "Glypican 3, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.