IgG Fc Secondary Antibody | IgG secondary antibody
Goat anti-Rabbit IgG Fc, HRP, AffiPure
Gene Names
FCGR2A; CD32; FCG2; FcGR; CD32A; CDw32; FCGR2; IGFR2; FCGR2A1
Synonyms
IgG Fc; Goat anti-Rabbit IgG Fc; HRP; AffiPure; Chicken CCL20 Recombinant Protein; IgG secondary antibody
Host
Yeast
Form/Format
Lyophilized
Sequence
QSNQDCCLSYSKVRLPRKVIKGFTEQLSGEVCDIDAIIFHTVRGLKACVNPKEDWVKKHL LFLSQKLKRMSM (72)
Sequence Length
315
Application Notes
The Chicken CCL20 protein can be used in cell culture, as an CCL20 ELISA Standard, and as a Western Blot Control.
Contains
Recombinant proteins produced in yeast.
Preparation and Storage
Store at -20 degree C.
Related Product Information for IgG secondary antibody
Description: Chemokine ligand 20 (CCL20), also known as liver activation regulated chemokine (LARC) or Macrophage Inflammatory Protein-3 (MIP3A), is strongly chemotactic for lymphocytes. CCL20 elicits its effects on its target cells by binding and activating the chemokine receptor CCR6. Chicken CCL20 Recombinant Protein is purified CCL20 (LARC, MIP3A) produced in yeast.
Background: Chemokine ligand 20 (CCL20), also known as liver activation regulated chemokine (LARC) or Macrophage Inflammatory Protein-3 (MIP3A), is a small cytokine belonging to the CC chemokine family. There are at least 27 distinct members of the C-C subgroup reported for mammals, characterized by two adjacent cysteines. CC chemokines induce the migration of monocytes and other cell types such as NK cells and dendritic cells. CCL20/LARC/MIP-3A is strongly chemotactic for lymphocytes. CCL20 elicits its effects on its target cells by binding and activating the chemokine receptor CCR6.
Background: Chemokine ligand 20 (CCL20), also known as liver activation regulated chemokine (LARC) or Macrophage Inflammatory Protein-3 (MIP3A), is a small cytokine belonging to the CC chemokine family. There are at least 27 distinct members of the C-C subgroup reported for mammals, characterized by two adjacent cysteines. CC chemokines induce the migration of monocytes and other cell types such as NK cells and dendritic cells. CCL20/LARC/MIP-3A is strongly chemotactic for lymphocytes. CCL20 elicits its effects on its target cells by binding and activating the chemokine receptor CCR6.
Product Categories/Family for IgG secondary antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
Molecular Weight
8.3 kDa
NCBI Official Full Name
IgG Fc receptor
NCBI Official Synonym Full Names
Fc fragment of IgG receptor IIa
NCBI Official Symbol
FCGR2A
NCBI Official Synonym Symbols
CD32; FCG2; FcGR; CD32A; CDw32; FCGR2; IGFR2; FCGR2A1
NCBI Protein Information
low affinity immunoglobulin gamma Fc region receptor II-a
NCBI Description
This gene encodes one member of a family of immunoglobulin Fc receptor genes found on the surface of many immune response cells. The protein encoded by this gene is a cell surface receptor found on phagocytic cells such as macrophages and neutrophils, and is involved in the process of phagocytosis and clearing of immune complexes. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Oct 2008]
Research Articles on IgG
Similar Products
Product Notes
The IgG (Catalog #AAA258086) is a Secondary Antibody produced from Yeast and is intended for research purposes only. The product is available for immediate purchase. The Chicken CCL20 protein can be used in cell culture, as an CCL20 ELISA Standard, and as a Western Blot Control. Researchers should empirically determine the suitability of the IgG for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: QSNQDCCLSY SKVRLPRKVI KGFTEQLSGE VCDIDAIIFH TVRGLKACVN PKEDWVKKHL LFLSQKLKRM SM (72). It is sometimes possible for the material contained within the vial of "IgG Fc, Secondary Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
