Mouse anti-Human DARS Monoclonal Antibody | anti-DARS antibody

DARS (Aspartyl-tRNA Synthetase, Cytoplasmic, Aspartate-tRNA Ligase, AspRS, Cell Proliferation-inducing Gene 40 Protein, PIG40) (PE)

• Gene Names: DARS; HBSL; aspRS
• Reactivity: Human
• Applications: ELISA, Immunohistochemistry, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: DARS; Monoclonal Antibody; DARS (Aspartyl-tRNA Synthetase; Cytoplasmic; Aspartate-tRNA Ligase; AspRS; Cell Proliferation-inducing Gene 40 Protein; PIG40) (PE); anti-DARS antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 2F11
• Specificity: Recognizes human DARS.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).

• Applicable Applications for anti-DARS antibody: ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
• Application Notes: IHC-P: 3ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa393-500 from human DARS (NP_001340) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: KYPLAVRPFYTMPDPRNPKQSNSYDMFMRGEEILSGAQRIHDPQLLTERALHHGIDLEKIKAYIDSFRFGAPPHAGGGIGLERVTMLFLGLHNVRQTSMFPRDPKRLT
• Conjugate: PE
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

WB (Western Blot)

(DARS monoclonal antibody Western Blot analysis of DARS expression in HeLa.)

WB (Western Blot)

(Western blot analysis of DARS over-expressed 293 cell line, cotransfected with DARS Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with DARS monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)

Application Data

(Detection limit for recombinant GST tagged DARS is ~0.3ng/ml as a capture antibody.)

IHC (Immunohistochemistry)

(Immunoperoxidase of monoclonal antibody to DARS on formalin-fixed paraffin-embedded human colon. [antibody concentration 3ug/ml].)

WB (Western Blot)

(Western Blot analysis of DARS expression in transfected 293T cell line by DARS monoclonal antibody. Lane 1: DARS transfected lysate (57.1kD). Lane 2: Non-transfected lysate.)

WB (Western Blot)

(Western Blot detection against Immunogen (37.62kD).)

Product Categories/Family for anti-DARS antibody

Antibodies; Enzymes; Synthase

References

1. Proteomic identification of putative biomarkers of radiotherapy resistance: a possible role for the 26S proteasome? Smith L, Qutob O, Watson MB, Beavis AW, Potts D, Welham KJ, Garimella V, Lind MJ, Drew PJ, Cawkwell L.Neoplasia. 2009 Nov;11(11):1194-207.

NCBI and Uniprot Product Information

• NCBI GI #: 45439306
• NCBI GeneID: 1615
• NCBI Accession #: NP_001340
• NCBI GenBank Nucleotide #: NM_001349
• UniProt Accession #: P14868; Q2TNI3; Q32Q69; Q53HV4; Q53YC5; Q68CR9; Q9BW52; A8K3J2; D3DP77
• Molecular Weight: 59.3 kDa (521aa)
• NCBI Official Full Name: aspartate--tRNA ligase, cytoplasmic isoform 1
• NCBI Official Synonym Full Names: aspartyl-tRNA synthetase
• NCBI Official Symbol: DARS
• NCBI Official Synonym Symbols: HBSL; aspRS
• NCBI Protein Information: aspartate--tRNA ligase, cytoplasmic
• UniProt Protein Name: Aspartate--tRNA ligase, cytoplasmic
• UniProt Gene Name: DARS
• UniProt Synonym Gene Names: AspRS
• UniProt Entry Name: SYDC_HUMAN