Mouse ILK Monoclonal Antibody | anti-ILK antibody

ILK (Integrin-linked Protein Kinase, 59kD Serine/Threonine-protein Kinase, ILK-1, ILK-2, p59ILK, ILK1, ILK2, DKFZp686F1765) (FITC)

• Gene Names: ILK; P59; ILK-1; ILK-2; p59ILK; HEL-S-28
• Reactivity: Human, Mouse, Rat
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: ILK; Monoclonal Antibody; ILK (Integrin-linked Protein Kinase; 59kD Serine/Threonine-protein Kinase; ILK-1; ILK-2; p59ILK; ILK1; ILK2; DKFZp686F1765) (FITC); anti-ILK antibody

• Host: Mouse
• Reactivity: Human, Mouse, Rat
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 4F10
• Specificity: Recognizes human ILK. Species Crossreactivity: mouse and rat.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).

• Applicable Applications for anti-ILK antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa341-452 from human ILK (AAH01554) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: KFSFQCPGRMYAPAWVAPEALQKKPEDTNRRSADMWSFAVLLWELVTREVPFADLSNMEIGMKVALEGLRPTIPPGISPHVCKLMKICMNEDPAKRPKFDMIVPILEKMQDK
• Conjugate: FITC
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

WB (Western Blot)

(Western blot analysis of ILK over-expressed 293 cell line, cotransfected with ILK Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with ILK monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)

WB (Western Blot)

(ILK monoclonal antibody. Western Blot analysis of ILK expression in NIH/3T3.)

Application Data

(Detection limit for recombinant GST tagged ILK is ~3ng/ml as a capture antibody.)

WB (Western Blot)

(ILK monoclonal antibody. Western Blot analysis of ILK expression in HepG2.)

WB (Western Blot)

(ILK monoclonal antibody. Western Blot analysis of ILK expression in PC-12.)

WB (Western Blot)

(ILK monoclonal antibody Western Blot analysis of ILK expression in HeLa.)

WB (Western Blot)

(Western Blot detection against Immunogen (38.06kD).)

Related Product Information for anti-ILK antibody

Receptor-proximal protein kinase regulating integrin-mediated signal transduction. May act as a mediator of inside-out integrin signaling. Focal adhesion protein part of the complex ILK-PINCH. This complex is considered to be one of the convergence points of integrin- and growth factor-signaling pathway. Could be implicated in mediating cell architecture, adhesion to integrin substrates and anchorage-dependent growth in epithelial cells. Phosphorylates beta-1 and beta-3 integrin subunit on serine and threonine residues, but also AKT1 and GSK3B.

Product Categories/Family for anti-ILK antibody

Antibodies; Protein Kinases

NCBI and Uniprot Product Information

• NCBI GI #: 16306740
• NCBI GeneID: 3611
• Molecular Weight: 36,467 Da
• NCBI Official Full Name: Homo sapiens integrin-linked kinase, mRNA
• NCBI Official Synonym Full Names: integrin linked kinase
• NCBI Official Symbol: ILK
• NCBI Official Synonym Symbols: P59; ILK-1; ILK-2; p59ILK; HEL-S-28
• NCBI Protein Information: integrin-linked protein kinase