Mouse anti-Human SDCBP Monoclonal Antibody | anti-SDCBP antibody

SDCBP (Syndecan-binding Protein 1, Melanoma Differentiation-associated Protein 9, MDA9, MDA-9, Pro-TGF-alpha Cytoplasmic Domain-interacting Protein 18, TACIP18, Scaffold Protein Pbp1, SYCL, Syntenin-1, ST1) (Biotin)

• Gene Names: SDCBP; ST1; MDA9; SYCL; MDA-9; TACIP18
• Reactivity: Human
• Applications: ELISA, Immunofluorescence, Immunohistochemistry, Immunoprecipitation, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: SDCBP; Monoclonal Antibody; SDCBP (Syndecan-binding Protein 1; Melanoma Differentiation-associated Protein 9; MDA9; MDA-9; Pro-TGF-alpha Cytoplasmic Domain-interacting Protein 18; TACIP18; Scaffold Protein Pbp1; SYCL; Syntenin-1; ST1) (Biotin); anti-SDCBP antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 2C12
• Specificity: Recognizes human SDCBP.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.

• Applicable Applications for anti-SDCBP antibody: ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunoprecipitation (IP), Western Blot (WB)
• Application Notes: IF: 35ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa1-101 from human SDCBP (NP_005616) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MSLYPSLEDLKVDKVIQAQTAFSANPANPAILSEASAPIPHDGNLYPRLYPELSQYMGLSLNEEEIRANVAVVSGAPLQGQLVARPSSINYMVAPVTGND*
• Conjugate: Biotin
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Application Data

(Detection limit for recombinant GST tagged SDCBP is ~0.03ng/ml as a capture antibody.)

IP (Immunoprecipitation)

(Immunoprecipitation of SDCBP transfected lysate using SDCBP monoclonal antibody and Protein A Magnetic Bead and immunoblotted with SDCBP rabbit polyclonal antibody.)

IF (Immunofluorescence)

(Immunofluorescence of monoclonal antibody to SDCBP on HepG2 cell. [antibody concentration 35ug/ml].)

IHC (Immunohistochemistry)

(Immunoperoxidase of monoclonal antibody to SDCBP on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 3ug/ml].)

WB (Western Blot)

(Western Blot analysis of SDCBP expression in transfected 293T cell line by SDCBP monoclonal antibody. Lane 1: SDCBP transfected lysate (32.4kD). Lane 2: Non-transfected lysate.)

WB (Western Blot)

(SDCBP monoclonal antibody, Western Blot analysis of SDCBP expression in HepG2.)

WB (Western Blot)

(Western Blot detection against Immunogen (37.11kD).)

Product Categories/Family for anti-SDCBP antibody

Antibodies; Binding Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 56243522
• NCBI GeneID: 6386
• NCBI Accession #: NP_005616
• NCBI GenBank Nucleotide #: NM_005625
• UniProt Accession #: O00560; O00173; O43391; Q14CP2; B2R5Q7; B4DUH3; B7ZLN2
• Molecular Weight: 34.6kDa (318aa), confirmed by MALDI-TOF
• NCBI Official Full Name: syntenin-1 isoform 1
• NCBI Official Synonym Full Names: syndecan binding protein
• NCBI Official Symbol: SDCBP
• NCBI Official Synonym Symbols: ST1; MDA9; SYCL; MDA-9; TACIP18
• NCBI Protein Information: syntenin-1
• UniProt Protein Name: Syntenin-1
• UniProt Gene Name: SDCBP
• UniProt Synonym Gene Names: MDA9; SYCL; MDA-9; TACIP18
• UniProt Entry Name: SDCB1_HUMAN