Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA23453_WB7.jpg WB (Western Blot) (WB Suggested Anti-JAZF1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Jurkat cell lysate)

Rabbit JAZF1 Polyclonal Antibody | anti-JAZF1 antibody

JAZF1 antibody - N-terminal region

Gene Names
JAZF1; TIP27; ZNF802
Reactivity
Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
JAZF1, Antibody; JAZF1 antibody - N-terminal region; anti-JAZF1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: IDTDPRVLEKQELQQPTYVALSYINRFMTDAARREQESLKKKIQPKLSLT
Sequence Length
243
Applicable Applications for anti-JAZF1 antibody
WB (Western Blot)
Homology
Dog: 92%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human JAZF1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-JAZF1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Jurkat cell lysate)

product-image-AAA23453_WB7.jpg WB (Western Blot) (WB Suggested Anti-JAZF1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Jurkat cell lysate)

WB (Western Blot)

(Host: RabbitTarget Name: JAZF1Sample Type: NTERA2Antibody Dilution: 1.0ug/ml)

product-image-AAA23453_WB6.jpg WB (Western Blot) (Host: RabbitTarget Name: JAZF1Sample Type: NTERA2Antibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: JAZF1Sample Type: MCF7Antibody Dilution: 1.0ug/ml)

product-image-AAA23453_WB5.jpg WB (Western Blot) (Host: RabbitTarget Name: JAZF1Sample Type: MCF7Antibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: JAZF1Sample Type: JurkatAntibody Dilution: 1.0ug/ml)

product-image-AAA23453_WB4.jpg WB (Western Blot) (Host: RabbitTarget Name: JAZF1Sample Type: JurkatAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: JAZF1Sample Type: Human Adult PlacentaAntibody Dilution: 1.0ug/ml)

product-image-AAA23453_WB3.jpg WB (Western Blot) (Host: RabbitTarget Name: JAZF1Sample Type: Human Adult PlacentaAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: JAZF1Sample Type: HepG2Antibody Dilution: 1.0ug/ml)

product-image-AAA23453_WB2.jpg WB (Western Blot) (Host: RabbitTarget Name: JAZF1Sample Type: HepG2Antibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: JAZF1Sample Type: HelaAntibody Dilution: 1.0ug/ml)

product-image-AAA23453_WB.jpg WB (Western Blot) (Host: RabbitTarget Name: JAZF1Sample Type: HelaAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-JAZF1 antibody
This is a rabbit polyclonal antibody against JAZF1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: JAZF1 is a nuclear protein with three C2H2-type zinc fingers, and functions as a transcriptional repressor. Chromosomal aberrations involving this gene are associated with endometrial stromal tumors. This gene encodes a nuclear protein with three C2H2-type zinc fingers, and functions as a transcriptional repressor. Chromosomal aberrations involving this gene are associated with endometrial stromal tumors. Alternatively spliced variants which encode different protein isoforms have been described; however, not all variants have been fully characterized.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
27kDa
NCBI Official Full Name
juxtaposed with another zinc finger protein 1
NCBI Official Synonym Full Names
JAZF zinc finger 1
NCBI Official Symbol
JAZF1
NCBI Official Synonym Symbols
TIP27; ZNF802
NCBI Protein Information
juxtaposed with another zinc finger protein 1
UniProt Protein Name
Juxtaposed with another zinc finger protein 1
UniProt Gene Name
JAZF1
UniProt Synonym Gene Names
TIP27; ZNF802
UniProt Entry Name
JAZF1_HUMAN

Similar Products

Product Notes

The JAZF1 jazf1 (Catalog #AAA23453) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The JAZF1 antibody - N-terminal region reacts with Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's JAZF1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the JAZF1 jazf1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: IDTDPRVLEK QELQQPTYVA LSYINRFMTD AARREQESLK KKIQPKLSLT. It is sometimes possible for the material contained within the vial of "JAZF1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.