Rabbit anti-Human Crystallin Lambda 1 (CRYl1) Polyclonal Antibody | anti-CRYl1 antibody
Polyclonal Antibody to Crystallin Lambda 1 (CRYl1)
MHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTDDDDKAMADIGSEF-MASSAAGCVV IVGSGVIGRS WAMLFASGGF QVKLYDIEQQ QIRNALENIR KEMKLLEQAG SLKGSLSVEE QLSLISGCPN IQEAVEGAMH IQECVPEDLE LKKKIFAQLD SIIDDRVILS SSTSCLMPSK LFAGLVHVKQ CIVAHPVNPP YYIPLVELVP HPETAPTTVD RTHALMKKIG QCPMRVQKEV AGFVLNRLQY AIISEAWRLV EEGIVSPSDL DLVMSEGLGM RYAFIGPLET MHLNAEGMLS YCDRYSEGIK HVLQTFGPIP EFSRATAEKV NQDMCMKVPD DPEHLAARRQ WRDECLMRLA KLKSQVQPQ
Immunocytochemistry in formalin fixed cells: 1:100-500
Immunohistochemistry in formalin fixed frozen section: 1:100-500
Immunohistochemistry in paraffin section: 1:50-200
Enzyme-linked Immunosorbent Assay: 1:100-200
NCBI and Uniprot Product Information
NCBI Description
The uronate cycle functions as an alternative glucose metabolic pathway, accounting for about 5% of daily glucose catabolism. The product of this gene catalyzes the dehydrogenation of L-gulonate into dehydro-L-gulonate in the uronate cycle. The enzyme requires NAD(H) as a coenzyme, and is inhibited by inorganic phosphate. A similar gene in the rabbit is thought to serve a structural role in the lens of the eye. [provided by RefSeq, Jul 2008]
Uniprot Description
CRYL1: The uronate cycle functions as an alternative glucose metabolic pathway, accounting for about 5% of daily glucose catabolism. The product of this gene catalyzes the dehydrogenation of L-gulonate into dehydro-L-gulonate in the uronate cycle. The enzyme requires NAD(H) as a coenzyme, and is inhibited by inorganic phosphate. A similar gene in the rabbit is thought to serve a structural role in the lens of the eye. [provided by RefSeq, Jul 2008]
Protein type: EC 1.1.1.45
Chromosomal Location of Human Ortholog: 13q12.11
Cellular Component: cytosol
Molecular Function: 3-hydroxyacyl-CoA dehydrogenase activity; L-gulonate 3-dehydrogenase activity; protein homodimerization activity
Biological Process: fatty acid metabolic process; glucuronate catabolic process to xylulose 5-phosphate
Research Articles on CRYl1
Similar Products
Product Notes
The CRYl1 cryl1 (Catalog #AAA2006821) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Polyclonal Antibody to Crystallin Lambda 1 (CRYl1) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's Crystallin Lambda 1 (CRYl1) can be used in a range of immunoassay formats including, but not limited to, Immunocytochemistry (ICC), Immunohistochemistry (IHC) - Formalin/Paraffin, ELISA (EIA), Western Blot (WB). Western blotting: 1:100-400 Immunocytochemistry in formalin fixed cells: 1:100-500 Immunohistochemistry in formalin fixed frozen section: 1:100-500 Immunohistochemistry in paraffin section: 1:50-200 Enzyme-linked Immunosorbent Assay: 1:100-200. Researchers should empirically determine the suitability of the CRYl1 cryl1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Antigen: The target protein is fused with two N-terminal Tags, His-tag and its sequence is listed below. MHHHHHHSSG LVPRGSGMKE TAAAKFERQH MDSPDLGTDD DDKAMADIGS EF-MASSAAG CVV IVGSGVIGRS WAMLFASGGF QVKLYDIEQQ QIRNALENIR KEMKLLEQAG SLKGSLSVEE QLSLISGCPN IQEAVEGAMH IQECVPEDLE LKKKIFAQLD SIIDDRVILS SSTSCLMPSK LFAGLVHVKQ CIVAHPVNPP YYIPLVELVP HPETAPTTVD RTHALMKKIG QCPMRVQKEV AGFVLNRLQY AIISEAWRLV EEGIVSPSDL DLVMSEGLGM RYAFIGPLET MHLNAEGMLS YCDRYSEGIK HVLQTFGPIP EFSRATAEKV NQDMCMKVPD DPEHLAARRQ WRDECLMRLA KLKSQVQPQ. It is sometimes possible for the material contained within the vial of "Crystallin Lambda 1 (CRYl1), Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.