Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot: Sample: Recombinant protein.)

Rabbit anti-Mouse Insulin Like Growth Factor 2 (IGF2) Polyclonal Antibody | anti-IGF2 antibody

Polyclonal Antibody to Insulin Like Growth Factor 2 (IGF2)

Gene Names
Igf2; Mpr; M6pr; Peg2; Igf-2; Igf-II; AL033362
Reactivity
Mouse
Applications
Immunocytochemistry, Immunohistochemistry, ELISA, Western Blot
Purity
Affinity Chromatography
Synonyms
Insulin Like Growth Factor 2 (IGF2); Polyclonal Antibody; Polyclonal Antibody to Insulin Like Growth Factor 2 (IGF2); anti-IGF2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Mouse
Clonality
Polyclonal
Specificity
The antibody is a rabbit polyclonal antibody raised against IGF2. It has been selected for its ability to recognize IGF2 in immunohistochemical staining andwestern blotting.
Purity/Purification
Affinity Chromatography
Form/Format
Supplied as solution form in PBS, pH7.4, containing 0.02% NaN3,50% glycerol.
Concentration
500ug/mL (varies by lot)
Sequence
Antigen: The target protein is fused with two N-terminal Tags, His-tag and its sequence is listed below.
MGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRGSEF-AYGPGE TLCGGELVDT LQFVCSDRGF YFSRPSSRAN RRSRGIVEEC CFRSCDLALL ETYCATPAKS E
Sequence Length
215
Applicable Applications for anti-IGF2 antibody
Immunocytochemistry (ICC), Immunohistochemistry (IHC) - Formalin/Paraffin, ELISA (EIA), Western Blot (WB)
Application Notes
Western blotting: 1:100-400
Immunocytochemistry in formalin fixed cells: 1:100-500
Immunohistochemistry in formalin fixed frozen section: 1:100-500
Immunohistochemistry in paraffin section: 1:50-200
Enzyme-linked Immunosorbent Assay: 1:100-200
Immunogen
Recombinant IGF2 (Ala25~Glu91) expressed in E.coli.
Cross Reactivity
Mouse
Conjugated Antibody
The APC conjugated antibody version of this item is also available as catalog #MBS2036128
Preparation and Storage
Store at 4 degree C for frequent use. Stored at -20 degree C to -80 degree C in a manual defrost freezer for one year without detectable loss of activity. Avoid repeated freeze-thaw cycles.

Western Blot (WB)

(Western Blot: Sample: Recombinant protein.)

Western Blot (WB) (Western Blot: Sample: Recombinant protein.)

Immunohistochemistry (IHC)

(DAB staining on fromalin fixed paraffin-embedded testis tissue))

Immunohistochemistry (IHC) (DAB staining on fromalin fixed paraffin-embedded testis tissue))

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
21,061 Da
NCBI Official Full Name
insulin-like growth factor II isoform 2 preproprotein
NCBI Official Synonym Full Names
insulin-like growth factor 2
NCBI Official Symbol
Igf2
NCBI Official Synonym Symbols
Mpr; M6pr; Peg2; Igf-2; Igf-II; AL033362
NCBI Protein Information
insulin-like growth factor II
UniProt Protein Name
Insulin-like growth factor II
UniProt Gene Name
Igf2
UniProt Synonym Gene Names
Igf-2

NCBI Description

This gene encodes a member of the insulin-like growth factor (IGF) family of proteins that promote growth and development during fetal and postnatal life. It is an imprinted gene that is expressed only from the paternal allele. The encoded protein undergoes proteolytic processing to generate a mature peptide. The transgenic overexpression of this gene in mice results in prenatal overgrowth, polyhydramnios, fetal and neonatal lethality, disproportionate organ overgrowth including tongue enlargement, and skeletal abnormalities. Mice lacking the encoded protein exhibit growth deficiency. Alternative splicing results in multiple transcript variants encoding different isoforms that may undergo similar processing to generate mature protein. [provided by RefSeq, Oct 2015]

Uniprot Description

The insulin-like growth factors possess growth-promoting activity (Probable). Major fetal growth hormone in mammals. Plays a key role in regulating fetoplacental development (Probable) (PubMed:2330056, PubMed:12087403). IGF-II is influenced by placental lactogen (Probable). Also involved in tissue differentiation (Probable). Positively regulates myogenic transcription factor MYOD1 function by facilitating the recruitment of transcriptional coactivators, thereby controlling muscle terminal differentiation (PubMed:16901893). In adults, involved in glucose metabolism in adipose tissue, skeletal muscle and liver (Probable).

Research Articles on IGF2

Similar Products

Product Notes

The IGF2 igf2 (Catalog #AAA2004312) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Polyclonal Antibody to Insulin Like Growth Factor 2 (IGF2) reacts with Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's Insulin Like Growth Factor 2 (IGF2) can be used in a range of immunoassay formats including, but not limited to, Immunocytochemistry (ICC), Immunohistochemistry (IHC) - Formalin/Paraffin, ELISA (EIA), Western Blot (WB). Western blotting: 1:100-400 Immunocytochemistry in formalin fixed cells: 1:100-500 Immunohistochemistry in formalin fixed frozen section: 1:100-500 Immunohistochemistry in paraffin section: 1:50-200 Enzyme-linked Immunosorbent Assay: 1:100-200. Researchers should empirically determine the suitability of the IGF2 igf2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Antigen: The target protein is fused with two N-terminal Tags, His-tag and its sequence is listed below. MGSSHHHHHH SSGLVPRGSH MASMTGGQQM GRGSEF-AYG PGE TLCGGELVDT LQFVCSDRGF YFSRPSSRAN RRSRGIVEEC CFRSCDLALL ETYCATPAKS E. It is sometimes possible for the material contained within the vial of "Insulin Like Growth Factor 2 (IGF2), Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.