Rabbit E2F4 Polyclonal Antibody | anti-E2F4 antibody

Anti-E2F4 Antibody

Cat. Num. AAA178813

• Gene Names: E2F4; E2F-4
• Reactivity: Human, Mouse, Rat
• Applications: Western Blot, Immunohistochemistry
• Purity: Immunogen affinity purified.
• Synonyms: E2F4; Polyclonal Antibody; Anti-E2F4 Antibody; E2F-4; Transcription factor E2F4; Q16254; E2F transcription factor 4; p107/p130-binding; anti-E2F4 antibody

• Host: Rabbit
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Isotype: IgG
• Purity/Purification: Immunogen affinity purified.
• Form/Format: Lyophilized; Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
• Sequence Length: 413

• Applicable Applications for anti-E2F4 antibody: Western Blot (WB), Immunohistochemistry (IHC) Paraffin
• Application Notes: Western Blot: 0.1-0.5ug/ml; Immunohistochemistry(IHC) Paraffin: 0.5-1ug/ml
• Notes: Tested Species: In-house tested species with positive results.; By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections.; Other applications have not been tested.
• Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human E2F4 (106-144aa ELQQREQELDQHKVWVQQSIRNVTEDVQNSCLAYVTHED), identical to the related mouse and rat sequences.
• Preparation and Storage: Store at -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

Western Blot (WB)

(Western blot analysis of E2F4 expression in HELA whole cell lysates (lane 1), U20S whole cell lysates (lane 2) and MCF-7 whole cell lysates (lane 3). E2F4 at 44KD, 60KD was detected using rabbit anti- E2F4 Antigen Affinity purified polyclonal antibody at 0.5ug/mL. The blot was developed using chemiluminescence (ECL) method. )

Immunohistochemistry (IHC)

(E2F4 was detected in paraffin-embedded sections of mouse intestine tissues using rabbit anti- E2F4 Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method. )

Immunohistochemistry (IHC)

(E2F4 was detected in paraffin-embedded sections of rat intestine tissues using rabbit anti- E2F4 Antigen Affinity purified polyclonal antibody at 1 ug/mL. The immunohistochemical section was developed using SABC method. )

Immunohistochemistry (IHC)

(E2F4 was detected in paraffin-embedded sections of human intetsinal cancer tissues using rabbit anti- E2F4 Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method. )

Related Product Information for anti-E2F4 antibody

Rabbit IgG polyclonal antibody for Transcription factor E2F4(E2F4) detection.
Background: Transcription factor E2F4 is a protein that in humans is encoded by the E2F4 gene. The protein encoded by this gene is a member of the E2F family of transcription factors. This gene is mapped to 16q22.1. The E2F family plays a crucial role in the control of cell cycle and action of tumor suppressor proteins and is also a target of the transforming proteins of small DNA tumor viruses. These domains include a DNA binding domain, a dimerization domain which determines interaction with the differentiation regulated transcription factor proteins (DP), a transactivation domain enriched in acidic amino acids, and a tumor suppressor protein association domain which is embedded within the transactivation domain. This protein binds to all three of the tumor suppressor proteins pRB, p107 and p130, but with higher affinity to the last two. Additionally, it plays an important role in the suppression of proliferation-associated genes, and its gene mutation and increased expression may be associated with human cancer.

References

1. Ginsberg, D., Vairo, G., Chittenden, T., Xiao, Z.-X., Xu, G., Wydner, K. L., DeCaprio, J. A., Lawrence, J. B., Livingston, D. M. E2F-4, a new member of the E2F transcription factor family, interacts with p107. Genes Dev. 8: 2665-2679, 1994.
2. Leone, G., Sears, R., Huang, E., Rempel, R., Nuckolls, F., Park, C.-H., Giangrande, P., Wu, L., Saavedra, H. I., Field, S. J., Thompson, M. A., Yang, H., Fujiwara, Y., Greenberg, M. E., Orkin, S., Smith, C., Nevins, J. R. Myc requires distinct E2F activities to induce S phase and apoptosis. Molec. Cell 8: 105-113, 2001.

NCBI and Uniprot Product Information

• NCBI GI #: 12669915
• NCBI GeneID: 1874
• NCBI Accession #: NP_001941.2
• NCBI GenBank Nucleotide #: NM_001950.3
• UniProt Accession #: Q16254; Q12991; Q15328; A6NGR8; B5BU56
• Molecular Weight: 43,960 Da
• NCBI Official Full Name: transcription factor E2F4
• NCBI Official Synonym Full Names: E2F transcription factor 4
• NCBI Official Symbol: E2F4
• NCBI Official Synonym Symbols: E2F-4
• NCBI Protein Information: transcription factor E2F4
• UniProt Protein Name: Transcription factor E2F4
• Protein Family: Transcription factor
• UniProt Gene Name: E2F4
• UniProt Synonym Gene Names: E2F-4

NCBI Description

The protein encoded by this gene is a member of the E2F family of transcription factors. The E2F family plays a crucial role in the control of cell cycle and action of tumor suppressor proteins and is also a target of the transforming proteins of small DNA tumor viruses. The E2F proteins contain several evolutionally conserved domains found in most members of the family. These domains include a DNA binding domain, a dimerization domain which determines interaction with the differentiation regulated transcription factor proteins (DP), a transactivation domain enriched in acidic amino acids, and a tumor suppressor protein association domain which is embedded within the transactivation domain. This protein binds to all three of the tumor suppressor proteins pRB, p107 and p130, but with higher affinity to the last two. It plays an important role in the suppression of proliferation-associated genes, and its gene mutation and increased expression may be associated with human cancer. [provided by RefSeq, Jul 2008]

Uniprot Description

E2F4: Transcription activator that binds DNA cooperatively with DP proteins through the E2 recognition site, 5'-TTTC[CG]CGC- 3' found in the promoter region of a number of genes whose products are involved in cell cycle regulation or in DNA replication. The DRTF1/E2F complex functions in the control of cell-cycle progression from G1 to S phase. E2F4 binds with high affinity to RBL1 and RBL2. In some instances can also bind RB1. Belongs to the E2F/DP family.

Protein type: DNA-binding

Chromosomal Location of Human Ortholog: 16q22.1

Cellular Component: nuclear chromatin; nucleoplasm

Molecular Function: DNA binding; protein binding; protein domain specific binding; transcription factor activity; transcription factor binding

Biological Process: DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest; positive regulation of transcription from RNA polymerase II promoter