Western Blot (WB)
(Western blot analysis of ST7 expression in PANC whole cell lysates (lane 1). ST7 at 67KD was detected using rabbit anti- ST7 Antigen Affinity purified polyclonal antibody at 0.5ug/mL. The blot was developed using chemiluminescence (ECL) method. )
Rabbit anti-Human ST7 Polyclonal Antibody | anti-ST7 antibody
Anti-ST7 Antibody
Gene Names
ST7; HELG; RAY1; SEN4; TSG7; ETS7q; FAM4A; FAM4A1
Reactivity
Human
Applications
Western Blot
Purity
Immunogen affinity purified.
Synonyms
ST7; Polyclonal Antibody; Anti-ST7 Antibody; ETS7q; FAM4A; FAM4A1; HELG; RAY1; SEN4; TSG7; Q9NRC1; Suppressor of tumorigenicity 7 protein; suppression of tumorigenicity 7; anti-ST7 antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Immunogen affinity purified.
Form/Format
Lyophilized
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
554
Applicable Applications for anti-ST7 antibody
Western Blot (WB)
Application Notes
Western Blot: 0.1-0.5ug/ml
Notes
Tested Species: In-house tested species with positive results.
Other applications have not been tested.
Other applications have not been tested.
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Immunogen
A synthetic peptide corresponding to a sequence in the middle region of human ST7 (268-309aa DGCYRRSQQLQHHGSQYEAQHRRDTNVLVYIKRRLAMCARRL), identical to the related mouse and rat sequences.
Preparation and Storage
Store at -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.
Western Blot (WB)
(Western blot analysis of ST7 expression in PANC whole cell lysates (lane 1). ST7 at 67KD was detected using rabbit anti- ST7 Antigen Affinity purified polyclonal antibody at 0.5ug/mL. The blot was developed using chemiluminescence (ECL) method. )
Western Blot (WB)
(Western blot analysis of ST7 expression in PANC whole cell lysates (lane 1). ST7 at 67KD was detected using rabbit anti- ST7 Antigen Affinity purified polyclonal antibody at 0.5ug/mL. The blot was developed using chemiluminescence (ECL) method. )
Related Product Information for anti-ST7 antibody
Rabbit IgG polyclonal antibody for Suppressor of tumorigenicity 7 protein(ST7) detection.
Background: Suppressor of tumorigenicity protein 7 is a protein that in humans is encoded by the ST7 gene. The gene for this product maps to a region on chromosome 7 identified as an autism-susceptibility locus. Mutation screening of the entire coding region in autistic individuals failed to identify phenotype-specific variants, suggesting that coding mutations for this gene are unlikely to be involved in the etiology of autism. The function of this gene product has not been determined. Transcript variants encoding different isoforms of this protein have been described.
Background: Suppressor of tumorigenicity protein 7 is a protein that in humans is encoded by the ST7 gene. The gene for this product maps to a region on chromosome 7 identified as an autism-susceptibility locus. Mutation screening of the entire coding region in autistic individuals failed to identify phenotype-specific variants, suggesting that coding mutations for this gene are unlikely to be involved in the etiology of autism. The function of this gene product has not been determined. Transcript variants encoding different isoforms of this protein have been described.
References
1. Ogata T, Ayusawa D, Namba M, Takahashi E, Oshimura M, Oishi M (October 1993). "Chromosome 7 suppresses indefinite division of nontumorigenic immortalized human fibroblast cell lines KMST-6 and SUSM-1". Molecular and Cellular Biology. 13 (10): 6036-43.
2. Zenklusen JC, Rodriguez LV, LaCava M, Wang Z, Goldstein LS, Conti CJ (November 1996). "Novel susceptibility locus for mouse hepatomas: evidence for a conserved tumor suppressor gene". Genome Research. 6 (11): 1070-6.
2. Zenklusen JC, Rodriguez LV, LaCava M, Wang Z, Goldstein LS, Conti CJ (November 1996). "Novel susceptibility locus for mouse hepatomas: evidence for a conserved tumor suppressor gene". Genome Research. 6 (11): 1070-6.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
45,665 Da
NCBI Official Full Name
suppressor of tumorigenicity 7 protein isoform a
NCBI Official Synonym Full Names
suppression of tumorigenicity 7
NCBI Official Symbol
ST7
NCBI Official Synonym Symbols
HELG; RAY1; SEN4; TSG7; ETS7q; FAM4A; FAM4A1
NCBI Protein Information
suppressor of tumorigenicity 7 protein
UniProt Protein Name
Suppressor of tumorigenicity 7 protein
Protein Family
UniProt Gene Name
ST7
UniProt Synonym Gene Names
FAM4A1; HELG; RAY1
NCBI Description
The gene for this product maps to a region on chromosome 7 identified as an autism-susceptibility locus. Mutation screening of the entire coding region in autistic individuals failed to identify phenotype-specific variants, suggesting that coding mutations for this gene are unlikely to be involved in the etiology of autism. The function of this gene product has not been determined. Transcript variants encoding different isoforms of this protein have been described. [provided by RefSeq, Jul 2008]
Uniprot Description
ST7: May act as a tumor suppressor. Belongs to the ST7 family. 7 isoforms of the human protein are produced by alternative splicing.
Protein type: Membrane protein, integral; Membrane protein, multi-pass
Chromosomal Location of Human Ortholog: 7q31.2
Research Articles on ST7
Similar Products
Product Notes
The ST7 st7 (Catalog #AAA178704) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Anti-ST7 Antibody reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ST7 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Western Blot: 0.1-0.5ug/ml. Researchers should empirically determine the suitability of the ST7 st7 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ST7, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
