Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot analysis of iNOS expression in HELA whole cell lysates (lane 1). iNOS at 130KD was detected using rabbit anti- iNOS Antigen Affinity purified polyclonal antibody at 0.5ug/mL. The blot was developed using chemiluminescence (ECL) method. )

Rabbit anti-Human iNOS Polyclonal Antibody | anti-NOS2 antibody

Anti-iNOS Antibody

Gene Names
NOS2; NOS; INOS; NOS2A; HEP-NOS
Reactivity
Human
Applications
Western Blot
Purity
Immunogen affinity purified.
Synonyms
iNOS; Polyclonal Antibody; Anti-iNOS Antibody; Ascites; HEP NOS; Hepatocyte NOS; HEPNOS; HEP-NOS; Inducible NOS; NANOS2; nitric oxide synthase 2; inducible; NOS 2A; NOS2A; P60321; Nitric oxide synthase; anti-NOS2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Immunogen affinity purified.
Form/Format
Lyophilized
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
1153
Applicable Applications for anti-NOS2 antibody
Western Blot (WB)
Application Notes
Western Blot: 0.1-0.5ug/ml
Notes
Tested Species: In-house tested species with positive results.
Other applications have not been tested.
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human iNOS (1088-1126aa ARDVAHTLKQLVAAKLKLNEEQVEDYFFQLKSQKRYHED), different from the related mouse sequence by five amino acids, and from the related rat sequence by four amino acids.
Preparation and Storage
Store at -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

Western Blot (WB)

(Western blot analysis of iNOS expression in HELA whole cell lysates (lane 1). iNOS at 130KD was detected using rabbit anti- iNOS Antigen Affinity purified polyclonal antibody at 0.5ug/mL. The blot was developed using chemiluminescence (ECL) method. )

Western Blot (WB) (Western blot analysis of iNOS expression in HELA whole cell lysates (lane 1). iNOS at 130KD was detected using rabbit anti- iNOS Antigen Affinity purified polyclonal antibody at 0.5ug/mL. The blot was developed using chemiluminescence (ECL) method. )
Related Product Information for anti-NOS2 antibody
Rabbit IgG polyclonal antibody for Nitric oxide synthase, inducible(NOS2) detection.
Background: Nitric oxide synthase, inducible is an enzyme that in humans is encoded by the NOS2 gene. Nitric oxide (NO) is a messenger molecule with diverse functions throughout the body. In the brain and peripheral nervous system, NO displays many properties of a neurotransmitter; it is implicated in neurotoxicity associated with stroke and neurodegenerative diseases, neural regulation of smooth muscle, including peristalsis, and penile erection. Three different NOS isoforms have been identified which fall into two distinct types, constitutive and inducible. The inducible NOS (iNOS) isoform is expressed in a variety of cell types and tissues in response to inflammatory agents and cytokines. The human iNOS (NOS2) gene is approximately 37 kb in length and consists of 26 exons and 25 introns. NOS2-derived NO is a prerequisite for cytokine signaling and function in innate immunity.
References
1. Chartrain, N. A., Geller, D. A., Koty, P. P., Sitrin, N. F., Nussler, A. K., Hoffman, E. P., Billiar, T. R., Hutchinson, N. I., Mudgett, J. S. Molecular cloning, structure, and chromosomal localization of the human inducible nitric oxide synthase gene. J. Biol. Chem. 269: 6765-6772, 1994.
2. Diefenbach, A., Schindler, H., Rollinghoff, M., Yokoyama, W. M., Bogdan, C. Requirement for type 2 NO synthase for IL-12 signaling in innate immunity. Science 284: 951-955, 1999.
3. Hobbs, M. R., Udhayakumar, V., Levesque, M. C., Booth, J., Roberts, J. M., Tkachuk, A. N., Pole, A., Coon, H., Kariuki, S., Nahlen, B. L., Mwaikambo, E. D., Lai, A. L., Granger, D. L., Anstey, N. M., Weinberg, J. B. A new NOS2 promoter polymorphism associated with increased nitric oxide production and protection from severe malaria in Tanzanian and Kenyan children. Lancet 360: 1468-1475, 2002.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
126,749 Da
NCBI Official Full Name
nitric oxide synthase, inducible
NCBI Official Synonym Full Names
nitric oxide synthase 2
NCBI Official Symbol
NOS2
NCBI Official Synonym Symbols
NOS; INOS; NOS2A; HEP-NOS
NCBI Protein Information
nitric oxide synthase, inducible
UniProt Protein Name
Nitric oxide synthase, inducible
Protein Family
UniProt Gene Name
NOS2
UniProt Synonym Gene Names
NOS2A; HEP-NOS; Inducible NOS; iNOS

NCBI Description

Nitric oxide is a reactive free radical which acts as a biologic mediator in several processes, including neurotransmission and antimicrobial and antitumoral activities. This gene encodes a nitric oxide synthase which is expressed in liver and is inducible by a combination of lipopolysaccharide and certain cytokines. Three related pseudogenes are located within the Smith-Magenis syndrome region on chromosome 17. [provided by RefSeq, Jul 2008]

Uniprot Description

iNOS: Produces nitric oxide (NO) which is a messenger molecule with diverse functions throughout the body. In macrophages, NO mediates tumoricidal and bactericidal actions. Also has nitrosylase activity and mediates cysteine S-nitrosylation of cytoplasmic target proteins such COX2. Homodimer. Binds SLC9A3R1. By endotoxins and cytokines. Induced by IFNG/IFN-gamma acting synergistically with bacterial lipopolysaccharides (LPS), TNF or IL1B/interleukin-1 beta. Expressed in the liver, retina, bone cells and airway epithelial cells of the lung. Not expressed in the platelets. Regulated by calcium/calmodulin. Aspirin inhibits expression and function of this enzyme and effects may be exerted at the level of translational/post-translational modification and directly on the catalytic activity. Belongs to the NOS family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Amino Acid Metabolism - arginine and proline; EC 1.14.13.39; Oxidoreductase

Chromosomal Location of Human Ortholog: 17q11.2

Cellular Component: cytoplasm; cytosol; intracellular; nucleus; peroxisome

Molecular Function: FAD binding; FMN binding; heme binding; NADP binding; nitric-oxide synthase activity; protein binding; protein homodimerization activity; receptor binding

Biological Process: arginine catabolic process; cell redox homeostasis; defense response to bacterium; negative regulation of blood pressure; nitric oxide biosynthetic process; nitric oxide mediated signal transduction; peptidyl-cysteine S-nitrosylation; positive regulation of guanylate cyclase activity; positive regulation of killing of cells of another organism; positive regulation of leukocyte mediated cytotoxicity; positive regulation of vasodilation; prostaglandin secretion; regulation of cellular respiration; regulation of insulin secretion; superoxide metabolic process

Disease: Hypertension, Essential; Malaria, Susceptibility To

Research Articles on NOS2

Similar Products

Product Notes

The NOS2 nos2 (Catalog #AAA178606) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Anti-iNOS Antibody reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's iNOS can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Western Blot: 0.1-0.5ug/ml. Researchers should empirically determine the suitability of the NOS2 nos2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "iNOS, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.