Rabbit HMGB1 Polyclonal Antibody | anti-HMGB1 antibody

Anti-HMGB1 Antibody

Cat. Num. AAA178582

• Gene Names: HMGB1; HMG1; HMG3; HMG-1; SBP-1
• Reactivity: Human, Mouse, Rat
• Applications: Western Blot, Immunohistochemistry
• Purity: Immunogen affinity purified.
• Synonyms: HMGB1; Polyclonal Antibody; Anti-HMGB1 Antibody; Amphoterin; HMG-1; HMG1; HMG3; HMGB 1; SBP 1; P09429; High mobility group protein B1; high mobility group box 1; anti-HMGB1 antibody

• Host: Rabbit
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Isotype: IgG
• Purity/Purification: Immunogen affinity purified.
• Form/Format: Lyophilized; Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
• Sequence Length: 215

• Applicable Applications for anti-HMGB1 antibody: Western Blot (WB), Immunohistochemistry (IHC) Paraffin
• Application Notes: Western Blot: 0.1-0.5ug/ml; Immunohistochemistry(IHC) Paraffin: 0.5-1ug/ml
• Notes: Tested Species: In-house tested species with positive results.; By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections.; Other applications have not been tested.
• Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human HMGB1 (124-154aa DVAKKLGEMWNNTAADDKQPYEKKAAKLKEK), identical to the related mouse and rat sequences.
• Preparation and Storage: Store at -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

Western Blot (WB)

(Western blot analysis of HMGB1 expression in rat brain extract (lane 1), mouse ovary extract (lane 2), 22RV1 whole cell lysates (lane 3) and HELA whole cell lysates (lane 4). HMGB1 at 25KD was detected using rabbit anti- HMGB1 Antigen Affinity purified polyclonal antibody at 0.5ug/mL. The blot was developed using chemiluminescence (ECL) method. )

Immunohistochemistry (IHC)

(HMGB1 was detected in paraffin-embedded sections of mouse intestine tissues using rabbit anti- HMGB1 Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method. )

Immunohistochemistry (IHC)

(HMGB1 was detected in paraffin-embedded sections of mouse liver tissues using rabbit anti- HMGB1 Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method. )

Immunohistochemistry (IHC)

(HMGB1 was detected in paraffin-embedded sections of rat intestine tissues using rabbit anti- HMGB1 Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method. )

Immunohistochemistry (IHC)

(HMGB1 was detected in paraffin-embedded sections of rat liver tissues using rabbit anti- HMGB1 Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method. )

Immunohistochemistry (IHC)

(HMGB1 was detected in paraffin-embedded sections of human mammary cancer tissues using rabbit anti- HMGB1 Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method. )

Immunohistochemistry (IHC)

(HMGB1 was detected in paraffin-embedded sections of human placenta tissues using rabbit anti- HMGB1 Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method. )

Related Product Information for anti-HMGB1 antibody

Rabbit IgG polyclonal antibody for High mobility group protein B1(HMGB1) detection.
Background: High mobility group box 1 protein, also known as high-mobility group protein 1 (HMG-1) and amphoterin, is a protein that in humans is encoded by the HMGB1 gene. This gene encodes a protein that belongs to the High Mobility Group-box superfamily. The encoded non-histone, nuclear DNA-binding protein regulates transcription, and is involved in organization of DNA. This protein plays a role in several cellular processes, including inflammation, cell differentiation and tumor cell migration. Multiple pseudogenes of this gene have been identified. Alternative splicing results in multiple transcript variants that encode the same protein.

References

1. Ferrari S, Finelli P, Rocchi M, Bianchi ME (July 1996). "The active gene that encodes human high mobility group 1 protein (HMG1) contains introns and maps to chromosome 13". Genomics. 35 (2): 367-71.
2. Klune JR, Dhupar R, Cardinal J, Billiar TR, Tsung A (2008)."HMGB1: endogenous danger signaling". Mol. Med. 14 (7-8): 476-84.
3. Yang H, Hreggvidsdottir HS, Palmblad K, Wang H, Ochani M, Li J, Lu B, Chavan S, Rosas-Ballina M, Al-Abed Y, Akira S, Bierhaus A, Erlandsson-Harris H, Andersson U, Tracey KJ (June 2010). "A critical cysteine is required for HMGB1 binding to Toll-like receptor 4 and activation of macrophage cytokine release". Proc. Natl. Acad. Sci. U.S.A. 107 (26): 11942-7.

NCBI and Uniprot Product Information

• NCBI GI #: 926459555
• NCBI GeneID: 3146
• NCBI Accession #: NP_001300821.1
• NCBI GenBank Nucleotide #: NM_001313892.1
• UniProt Accession #: P09429; Q14321; Q5T7C3; Q6IBE1; A5D8W9
• Molecular Weight: 24,894 Da
• NCBI Official Full Name: high mobility group protein B1
• NCBI Official Synonym Full Names: high mobility group box 1
• NCBI Official Symbol: HMGB1
• NCBI Official Synonym Symbols: HMG1; HMG3; HMG-1; SBP-1
• NCBI Protein Information: high mobility group protein B1
• UniProt Protein Name: High mobility group protein B1
• Protein Family: High mobility group protein
• UniProt Gene Name: HMGB1
• UniProt Synonym Gene Names: HMG1; HMG-1

NCBI Description

This gene encodes a protein that belongs to the High Mobility Group-box superfamily. The encoded non-histone, nuclear DNA-binding protein regulates transcription, and is involved in organization of DNA. This protein plays a role in several cellular processes, including inflammation, cell differentiation and tumor cell migration. Multiple pseudogenes of this gene have been identified. Alternative splicing results in multiple transcript variants that encode the same protein. [provided by RefSeq, Sep 2015]

Uniprot Description

HMGB1: DNA binding proteins that associates with chromatin and has the ability to bend DNA. Binds preferentially single-stranded DNA. Involved in V(D)J recombination by acting as a cofactor of the RAG complex. Acts by stimulating cleavage and RAG protein binding at the 23 bp spacer of conserved recombination signal sequences (RSS). Heparin-binding protein that has a role in the extension of neurite-type cytoplasmic processes in developing cells. Component of the RAG complex composed of core components RAG1 and RAG2, and associated component HMGB1 or HMGB2. Belongs to the HMGB family.

Protein type: DNA repair, damage; Nuclear receptor co-regulator

Chromosomal Location of Human Ortholog: 13q12.3

Cellular Component: cell surface; condensed chromosome; extracellular region; extracellular space; nucleoplasm; nucleus; transcriptional repressor complex

Molecular Function: bubble DNA binding; C-X-C chemokine binding; chemoattractant activity; cytokine activity; damaged DNA binding; DNA bending activity; double-stranded DNA binding; four-way junction DNA binding; lipopolysaccharide binding; lyase activity; phosphatidylserine binding; protein binding; RAGE receptor binding; single-stranded DNA binding; transcription factor activity; transcription factor binding

Biological Process: activation of innate immune response; apoptotic cell clearance; dendritic cell chemotaxis; DNA fragmentation during apoptosis; DNA geometric change; DNA ligation during DNA repair; DNA recombination; DNA topological change; elevation of cytosolic calcium ion concentration; inflammatory response; inflammatory response to antigenic stimulus; innate immune response; myeloid dendritic cell activation; negative regulation of blood vessel endothelial cell migration; negative regulation of CD4-positive, alpha beta T cell differentiation; negative regulation of interferon-gamma production; negative regulation of transcription from RNA polymerase II promoter; negative regulation of transcriptional preinitiation complex assembly; neurite development; positive regulation of activated T cell proliferation; positive regulation of apoptosis; positive regulation of caspase activity; positive regulation of DNA binding; positive regulation of DNA ligation; positive regulation of interleukin-1 secretion; positive regulation of interleukin-10 production; positive regulation of interleukin-12 production; positive regulation of JNK cascade; positive regulation of MAPKKK cascade; positive regulation of mismatch repair; positive regulation of toll-like receptor 9 signaling pathway; positive regulation of transcription from RNA polymerase II promoter; regulation of autophagy; regulation of restriction endodeoxyribonuclease activity; regulation of T cell mediated immune response to tumor cell; regulation of tolerance induction; regulation of transcription from RNA polymerase II promoter; T-helper 1 cell differentiation; V(D)J recombination