anti-Human, Rat Heparanase 1 Polyclonal Antibody | anti-HPSE antibody

Anti-Heparanase 1 Antibody

Cat. Num. AAA178331

• Gene Names: HPSE; HPA; HPA1; HPR1; HSE1; HPSE1
• Reactivity: Human, Rat
• Applications: Western Blot
• Purity: Immunogen Affinity Purified
• Synonyms: Heparanase 1; Polyclonal Antibody; Anti-Heparanase 1 Antibody; Heparanase; Endo glucoronidase; Endo-glucoronidase; HEP; Heparanase 50 kDa subunit; Heparanase-1; Heparanase1; Hpa 1; HPA; Hpa1; HPR 1; HPR1; HPSE 1; HPSE; HPSE_HUMAN; HPSE1; HSE 1; HSE1 antibody; heparanase; anti-HPSE antibody

• Reactivity: Human, Rat
• Clonality: Polyclonal
• Specificity: No cross reactivity with other proteins.
• Purity/Purification: Immunogen Affinity Purified
• Form/Format: Lyophilized. ; Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na₂HPO₄, 0.05mg NaN₃.
• Sequence Length: 543

• Applicable Applications for anti-HPSE antibody: Western Blot (WB)
• Application Notes: Western Blot Concentration: 0.1-0.5ug/ml; Tested Species: Human, Rat.; ; WB: The detection limit for Heparanase 1 is approximately 0.1 ng/lane under reducing conditions.; ; Tested Species: In- house Tested species with positive results.; ; Othe applications have not been tested.; ; Optimal dilutions should be determined by end users.
• Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human Heparanase 1 (301-331aa NGRTATKEDFLNPDVLDIFISSVQKVFQVVE), different from the related mouse and rat sequences by eight amino acids.
• Ig Type: Rabbit IgG
• Reconstitution: 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Preparation and Storage: At -20°C for one year. After reconstitution, at 4°C for one month. It can also be aliquoted and stored frozen at -20°C for a longer time. Avoid repeated freezing and thawing.

Western Blot (WB)

(Anti- Heparanase 1 Picoband antibody, MBS178331, Western blottingAll lanes: Anti Heparanase 1 (MBS178331) at 0.5ug/mlLane 1: Rat Liver Tissue Lysate at 50ugLane 2: Human Placenta Tissue Lysate at 50ugLane 3: A549 Whole Cell Lysate at 40ugPredicted bind size: 61KDObserved bind size: 61KD )

Related Product Information for anti-HPSE antibody

Description: Rabbit IgG polyclonal antibody for Heparanase(HPSE) detection. Tested with WB in Human;Rat.

Background: Heparanase, also known as HPSE, is an enzyme that acts both at the cell-surface and within the extracellular matrix to degrade polymeric heparan sulfate molecules into shorter chain length oligosaccharides. Heparanase is an endo-beta-D-glucuronidase capable of cleaving heparan sulfate and has been implicated in inflammation and tumor angiogenesis and metastasis. The successful penetration of the endothelial cell layer that lines the interior surface of blood vessels is an important process in the formation of blood borne tumour metastases. Heparan sulfate proteoglycans are major constituents of this layer and it has been shown that increased metastatic potential corresponds with increased heparanase activity for a number of cell lines.

References

1. Hulett MD, Freeman C, Hamdorf BJ, Baker RT, Harris MJ, Parish CR (July 1999), "Cloning of mammalian heparanase, an important enzyme in tumor invasion and metastasis", Nature medicine 5 (7): 803-9. 2. Nakajima M, Irimura T, Nicolson GL. (1988), "Heparanases and tumor metastasis", J. Cell. Biochem. 36 (2): 157-167. 3. Toyoshima, M.; Nakajima, M. : Human heparanase: purification, characterization, cloning, and expression. J. Biol. Chem. 274: 24153-24160, 1999. 4. Vlodavsky I, Friedmann Y, Elkin M, Aingorn H, Atzmon R, Ishai-Michaeli R, Bitan M, Pappo O, Peretz T, Michal I, Spector L, Pecker I (July 1999), "Mammalian heparanase: gene cloning, expression and function in tumor progression and metastasis", Nature medicine 5 (7): 793-802. 5. Vlodavsky I, Goldshmidt O, Zcharia E, et al. (2003), "Mammalian heparanase: involvement in cancer metastasis, angiogenesis and normal development.", Semin. Cancer Biol. 12 (2): 121-9.

NCBI and Uniprot Product Information

• NCBI GI #: 148746204
• NCBI GeneID: 10855
• NCBI Accession #: NP_001092010.1
• NCBI GenBank Nucleotide #: NM_001098540.2
• UniProt Accession #: Q9Y251; Q53GE5; Q9UL39; A9JIG7; C7F7I3; C7F7I4; E9PCA9; E9PGR1
• NCBI Official Full Name: heparanase isoform 1 preproprotein
• NCBI Official Synonym Full Names: heparanase
• NCBI Official Symbol: HPSE
• NCBI Official Synonym Symbols: HPA; HPA1; HPR1; HSE1; HPSE1
• NCBI Protein Information: heparanase
• UniProt Protein Name: Heparanase
• Protein Family: Heparanase
• UniProt Gene Name: HPSE
• UniProt Synonym Gene Names: HEP; HPA; HPA1; HPR1; HPSE1; HSE1; Hpa1
• UniProt Entry Name: HPSE_HUMAN

NCBI Description

Heparan sulfate proteoglycans are major components of the basement membrane and extracellular matrix. The protein encoded by this gene is an enzyme that cleaves heparan sulfate proteoglycans to permit cell movement through remodeling of the extracellular matrix. In addition, this cleavage can release bioactive molecules from the extracellular matrix. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2011]

Uniprot Description

HPSE: Endoglycosidase that cleaves heparan sulfate proteoglycans (HSPGs) into heparan sulfate side chains and core proteoglycans. Participates in extracellular matrix (ECM) degradation and remodeling. Selectively cleaves the linkage between a glucuronic acid unit and an N-sulfo glucosamine unit carrying either a 3-O-sulfo or a 6-O-sulfo group. Can also cleave the linkage between a glucuronic acid unit and an N-sulfo glucosamine unit carrying a 2-O-sulfo group, but not linkages between a glucuronic acid unit and a 2-O-sulfated iduronic acid moiety. It is essentially inactive at neutral pH but becomes active under acidic conditions such as during tumor invasion and in inflammatory processes. Facilitates cell migration associated with metastasis, wound healing and inflammation. Enhances shedding of syndecans, and increases endothelial invasion and angiogenesis in myelomas. Acts as procoagulant by increasing the generation of activation factor X in the presence of tissue factor and activation factor VII. Increases cell adhesion to the extacellular matrix (ECM), independent of its enzymatic activity. Induces AKT1/PKB phosphorylation via lipid rafts increasing cell mobility and invasion. Heparin increases this AKT1/PKB activation. Regulates osteogenesis. Enhances angiogenesis through up- regulation of SRC-mediated activation of VEGF. Implicated in hair follicle inner root sheath differentiation and hair homeostasis. Belongs to the glycosyl hydrolase 79 family.

Protein type: Hydrolase; Glycan Metabolism - glycosaminoglycan degradation; EC 3.2.1.166; Secreted; Secreted, signal peptide; Extracellular matrix

Chromosomal Location of Human Ortholog: 4q21.3

Cellular Component: extracellular region; intracellular membrane-bound organelle; lipid raft; lysosomal lumen; lysosomal membrane; lysosome; nucleoplasm; nucleus

Molecular Function: beta-glucuronidase activity; heparanase activity; protein binding; protein dimerization activity; syndecan binding

Biological Process: carbohydrate metabolic process; cell-matrix adhesion; glycosaminoglycan catabolic process; heparan sulfate proteoglycan catabolic process; positive regulation of blood coagulation; positive regulation of hair follicle development; positive regulation of osteoblast proliferation; positive regulation of protein kinase B signaling cascade; proteoglycan metabolic process; regulation of hair follicle development