anti-Human, Rat IRF2 Polyclonal Antibody | anti-IRF2 antibody

Anti-IRF2 Antibody

Cat. Num. AAA178321

• Gene Names: IRF2; IRF-2
• Reactivity: Human, Rat
• Applications: Western Blot
• Purity: Immunogen Affinity Purified
• Synonyms: IRF2; Polyclonal Antibody; Anti-IRF2 Antibody; Interferon regulatory factor 2; DKFZp686F0244; IRF 2; IRF-2; IRF2_HUMAN antibody; interferon regulatory factor 2; anti-IRF2 antibody

• Reactivity: Human, Rat
• Clonality: Polyclonal
• Purity/Purification: Immunogen Affinity Purified
• Form/Format: Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
• Sequence Length: 349

• Applicable Applications for anti-IRF2 antibody: Western Blot (WB)
• Application Notes: Western Blot Concentration: 0.1-0.5ug/ml
• Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human IRF2 (317-348aa MTPASSSSRPDRETRASVIKKTSDITQARVKS), different from the related mouse sequence by three amino acids.
• Ig Type: Rabbit IgG
• Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Preparation and Storage: At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

Western Blot (WB)

(Anti- IRF2 Picoband antibody, MBS178321, Western blottingAll lanes: Anti IRF2 (MBS178321) at 0.5ug/mlLane 1: Rat Intestine Tissue Lysate at 50ugLane 2: SW620 Whole Cell Lysate at 40ugLane 3: COLO320 Whole Cell Lysate at 40ugLane 4: HELA Whole Cell Lysate at 40ugLane 5: A549 Whole Cell Lysate at 40ugPredicted bind size: 39KDObserved bind size: 50KD)

Related Product Information for anti-IRF2 antibody

Description: Rabbit IgG polyclonal antibody for Interferon regulatory factor 2(IRF2) detection. Tested with WB in Human;Rat.

Background: IRF2 (interferon regulatory factor 2) is a member of the interferon regulatory transcription factor (IRF) family. The IRF2 gene is mapped on 4q35.1. When the IRF2 gene was overexpressed in NIH 3T3 cells, the cells became transformed and displayed enhanced tumorigenicity in nude mice. One IRF binding site was found within the IRF2 promoter, and expression of the IRF2 gene was affected by both transient and stable IRF1 expression. IRF2 competitively inhibits the IRF1-mediated transcriptional activation of interferons alpha and beta, and presumably other genes that employ IRF1 for transcription activation. However, IRF2 also functions as a transcriptional activator of histone H4. Irf2 was required to prevent NK-cell apoptosis and keep immature NK cells alive, thus promoting NK-cell maturation and their supply to peripheral blood.

References

1. Harada, H., Takahashi, E.-I., Itoh, S., Harada, K., Hori, T.-A., Taniguchi, T. Structure and regulation of the human interferon regulatory factor 1 (IRF-1) and IRF-2 genes: implications for a gene network in the interferon system. Molec. Cell. Biol. 14: 1500-1509, 1994. 2. Nishio, Y., Noguchi, E., Ito, S., Ichikawa, E., Umebayashi, Y., Otsuka, F., Arinami, T. Mutation and association analysis of the interferon regulatory factor 2 gene (IRF2) with atopic dermatitis. J. Hum. Genet. 46: 664-667, 2001. 3. Taki, S., Nakajima, S., Ichikawa, E., Saito, T., Hida, S. IFN regulatory factor-2 deficiency revealed a novel checkpoint critical for the generation of peripheral NK cells. J. Immun. 174: 6005-6012, 2005.

NCBI and Uniprot Product Information

• NCBI GI #: 153082752
• NCBI GeneID: 3660
• NCBI Accession #: NP_002190.2
• NCBI GenBank Nucleotide #: NM_002199.3
• UniProt Accession #: P14316; Q6IAS7; Q96B99; D6RCK5; H0Y8S3
• Molecular Weight: 39,156 Da
• NCBI Official Full Name: interferon regulatory factor 2
• NCBI Official Synonym Full Names: interferon regulatory factor 2
• NCBI Official Symbol: IRF2
• NCBI Official Synonym Symbols: IRF-2
• NCBI Protein Information: interferon regulatory factor 2
• UniProt Protein Name: Interferon regulatory factor 2
• Protein Family: Interferon regulatory factor
• UniProt Gene Name: IRF2
• UniProt Synonym Gene Names: IRF-2
• UniProt Entry Name: IRF2_HUMAN

NCBI Description

IRF2 encodes interferon regulatory factor 2, a member of the interferon regulatory transcription factor (IRF) family. IRF2 competitively inhibits the IRF1-mediated transcriptional activation of interferons alpha and beta, and presumably other genes that employ IRF1 for transcription activation. However, IRF2 also functions as a transcriptional activator of histone H4. [provided by RefSeq, Jul 2008]

Uniprot Description

IRF2: Specifically binds to the upstream regulatory region of type I IFN and IFN-inducible MHC class I genes (the interferon consensus sequence (ICS)) and represses those genes. Also acts as an activator for several genes including H4 and IL7. Constitutively binds to the ISRE promoter to activate IL7. Involved in cell cycle regulation through binding the site II (HiNF-M) promoter region of H4 and activating transcription during cell growth. Antagonizes IRF1 transcriptional activation. Interacts with BRD7, IRF2BP1 and IRF2BP2. Interacts with CREBBP in growing cells; the interaction acetylates IRF2 and regulates IRF2-dependent H4 promoter activity. By viruses and IFN. Expressed throughout the epithelium of the colon. Also expressed in lamina propria. Belongs to the IRF family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: DNA-binding; Transcription factor

Chromosomal Location of Human Ortholog: 4q34.1-q35.1

Cellular Component: cytoplasm; cytosol; focal adhesion; nucleoplasm

Molecular Function: DNA binding; protein binding; transcription factor activity

Biological Process: blood coagulation; cell proliferation; negative regulation of transcription from RNA polymerase II promoter; positive regulation of transcription from RNA polymerase II promoter; regulation of transcription, DNA-dependent; transcription from RNA polymerase II promoter