Villin Polyclonal Antibody | anti-VIL1 antibody

Anti-Villin Antibody

Cat. Num. AAA178308

• Gene Names: VIL1; VIL; D2S1471
• Reactivity: Human, Mouse, Rat
• Applications: Western Blot, Immunohistochemistry
• Purity: Immunogen Affinity Purified
• Synonyms: Villin; Polyclonal Antibody; Anti-Villin Antibody; Villin-1; D2S1471; OTTHUMP00000164145; VIL; VIL1; VILI_HUMAN; Villin 1; Villin1; villin 1; anti-VIL1 antibody

• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Purity/Purification: Immunogen Affinity Purified
• Form/Format: Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
• Sequence Length: 827

• Applicable Applications for anti-VIL1 antibody: Western Blot (WB), Immunohistochemistry (IHC) Paraffin
• Application Notes: Western Blot Concentration: 0.1-0.5ug/ml; Immunohistochemistry (IHC) Paraffin Concentration: 0.5-1ug/ml
• Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Villin (770-799 aa EQLVNKPVEELPEGVDPSRKEEHLSIEDFT), different from the related mouse sequence by three amino acids.
• Ig Type: Rabbit IgG
• Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Preparation and Storage: At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

Western Blot (WB)

(Anti- Villin Picoband antibody, MBS178308, Western blottingAll lanes: Anti Villin (MBS178308) at 0.5ug/mlLane 1: Rat Intestine Tissue Lysate at 50ugLane 2: Mouse Kidney Tissue Lysate at 50ugLane 3: RH35 Whole Cell Lysate at 40ugLane 4: HEPG2 Whole Cell Lysate at 40ugLane 5: MCF-7 Whole Cell Lysate at 40ugPredicted bind size: 93KDObserved bind size: 93KD)

Immunohistochemistry (IHC)

(Anti- Villin Picoband antibody, MBS178308,IHC(P)IHC(P): Mouse Intestine Tissue )

Immunohistochemistry (IHC)

(Anti- Villin Picoband antibody, MBS178308,IHC(P)IHC(P): Rat Intestine Tissue )

Immunohistochemistry (IHC)

(Anti- Villin Picoband antibody, MBS178308,IHC(P)IHC(P): Human Intestinal Cancer Tissue )

Related Product Information for anti-VIL1 antibody

Description: Rabbit IgG polyclonal antibody for Villin-1(VIL1) detection. Tested with WB, IHC-P in Human;Mouse;Rat.

Background: Villin is known as VIL1. This gene encodes a member of a family of calcium-regulated actin-binding proteins. This protein represents a dominant part of the brush border cytoskeleton which functions in the capping, severing, and bundling of actin filaments. Two mRNAs of 2.7 kb and 3.5 kb have been observed; they result from utilization of alternate poly-adenylation signals present in the terminal exon. In vertebrates, the villin proteins help to support the microfilaments of the microvilli of the brush border. It may play a role in cell plasticity through F-actin severing.

References

1. Friederich, E; Vancompernolle, K; Louvard, D; Vandekerckhove, J (1999). "Villin function in the organization of the actin cytoskeleton. Correlation of in vivo effects to its biochemical activities in vitro". The Journal of Biological Chemistry274 (38): 26751-60. 2. Meng, J; Vardar, D; Wang, Y; Guo, HC; Head, JF; McKnight, CJ (2005). "High-resolution crystal structures of villin headpiece and mutants with reduced F-actin binding activity". Biochemistry 44 (36): 11963-73.

NCBI and Uniprot Product Information

• NCBI GI #: 194394237
• NCBI GeneID: 7429
• NCBI Accession #: NP_009058.2
• NCBI GenBank Nucleotide #: NM_007127.2
• UniProt Accession #: P09327; Q53S11; Q96AC8; B2R9A7
• Molecular Weight: 46,567 Da
• NCBI Official Full Name: villin-1
• NCBI Official Synonym Full Names: villin 1
• NCBI Official Symbol: VIL1
• NCBI Official Synonym Symbols: VIL; D2S1471
• NCBI Protein Information: villin-1
• UniProt Protein Name: Villin-1
• Protein Family: Villin
• UniProt Gene Name: VIL1
• UniProt Synonym Gene Names: VIL
• UniProt Entry Name: VILI_HUMAN

NCBI Description

This gene encodes a member of a family of calcium-regulated actin-binding proteins. This protein represents a dominant part of the brush border cytoskeleton which functions in the capping, severing, and bundling of actin filaments. Two mRNAs of 2.7 kb and 3.5 kb have been observed; they result from utilization of alternate poly-adenylation signals present in the terminal exon. [provided by RefSeq, Jul 2008]

Uniprot Description

Villin: Epithelial cell-specific Ca(2+)-regulated actin- modifying protein that modulates the reorganization of microvillar actin filaments. Plays a role in the actin nucleation, actin filament bundle assembly, actin filament capping and severing. Binds phosphatidylinositol 4,5-bisphosphate (PIP2) and lysophosphatidic acid (LPA); binds LPA with higher affinity than PIP2. Binding to LPA increases its phosphorylation by SRC and inhibits all actin-modifying activities. Binding to PIP2 inhibits actin-capping and -severing activities but enhances actin-bundling activity. Regulates the intestinal epithelial cell morphology, cell invasion, cell migration and apoptosis. Protects against apoptosis induced by dextran sodium sulfate (DSS) in the gastrointestinal epithelium. Appears to regulate cell death by maintaining mitochondrial integrity. Enhances hepatocyte growth factor (HGF)-induced epithelial cell motility, chemotaxis and wound repair. Upon S.flexneri cell infection, its actin-severing activity enhances actin-based motility of the bacteria and plays a role during the dissemination. Monomer. Homodimer; homodimerization is necessary for actin-bundling. Associates with F-actin; phosphorylation at tyrosines residues decreases the association with F-actin. Interacts (phosphorylated at C-terminus tyrosine phosphorylation sites) with PLCG1 (via the SH2 domains). Interacts (phosphorylated form) with PLCG1; the interaction is enhanced by hepatocyte growth factor (HGF). Specifically expressed in epithelial cells. Major component of microvilli of intestinal epithelial cells and kidney proximal tubule cells. Expressed in canalicular microvilli of hepatocytes. Belongs to the villin/gelsolin family.

Protein type: Actin-binding; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 2q35

Cellular Component: actin filament bundle; brush border; cytoplasm; filopodium; filopodium tip; lamellipodium; microvillus; nucleoplasm; plasma membrane; ruffle

Molecular Function: actin filament binding; calcium ion binding; caspase inhibitor activity; identical protein binding; phosphatidylinositol-4,5-bisphosphate binding; protein binding; protein homodimerization activity

Biological Process: actin filament capping; actin filament depolymerization; actin filament polymerization; actin filament severing; actin nucleation; barbed-end actin filament capping; D-glucose absorption; epidermal growth factor receptor signaling pathway; epithelial cell differentiation; negative regulation of caspase activity; positive regulation of actin filament bundle formation; positive regulation of actin filament depolymerization; positive regulation of cell migration; positive regulation of multicellular organism growth; protein complex assembly; regulation of actin nucleation; regulation of cell shape; regulation of microvillus length; response to bacterium