Western Blot (WB)
(Anti- ADRA1A Picoband antibody, MBS178268, Western blottingAll lanes: Anti ADRA1A (MBS178268) at 0.5ug/mlLane 1: Rat Cardiac Muscle Tissue Lysate at 50ugLane 2: Rat Brain Tissue Lysate at 50ugLane 3: Rat Liver Tissue Lysate at 50ugLane 4: Mouse Liver Tissue Lysate at 50ugLane 5: Mouse Lung Tissue Lysate at 50ugLane 6: 22RV1 Whole Cell Lysate at 40ugLane 7: SMMC Whole Cell Lysate at 40ugPredicted bind size: 51KDObserved bind size: 51KD )
ADRA1A Polyclonal Antibody | anti-ADRA1A antibody
Anti-ADRA1A Antibody
Gene Names
ADRA1A; ADRA1C; ADRA1L1; ALPHA1AAR
Reactivity
Human, Mouse, Rat
Applications
Western Blot
Purity
Immunogen Affinity Purified
Synonyms
ADRA1A; Polyclonal Antibody; Anti-ADRA1A Antibody; Alpha-1A adrenergic receptor; ADA1D_HUMAN; Adra1; Adra1a; Adra1d; ADRA1R; Adrd1; Adrenergic alpha1A receptor; Adrenergic alpha1D receptor; Adrenergic receptor alpha 1d; Adrenergic receptor delta1; Adrenoceptor alpha 1D; Alpha 1D adrenoceptor; Alpha 1D adrenoreceptor; Alpha adrenergic receptor 1a; Alpha-1D adrenergic receptor; Alpha-1D adrenoceptor; Alpha-1D adrenoreceptor; Alpha-adrenergic receptor 1a; ALPHA1; Alpha1A adrenergic receptor; Alpha1D adrenergic receptor; Alpha1DAR; DAR; dJ779E11.2; Gpcr8; RA42; Spr8; adrenoceptor alpha 1A; anti-ADRA1A antibody
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Immunogen Affinity Purified
Form/Format
Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
466
Applicable Applications for anti-ADRA1A antibody
Western Blot (WB)
Application Notes
Western Blot Concentration: 0.1-0.5ug/ml
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human ADRA1A (335-373aa KAFQNVLRIQCLCRKQSSKHALGYTLHPPSQAVEGQHKD), different from the related mouse and rat sequences by four amino acids.
Ig Type
Rabbit IgG
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Preparation and Storage
At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.
Western Blot (WB)
(Anti- ADRA1A Picoband antibody, MBS178268, Western blottingAll lanes: Anti ADRA1A (MBS178268) at 0.5ug/mlLane 1: Rat Cardiac Muscle Tissue Lysate at 50ugLane 2: Rat Brain Tissue Lysate at 50ugLane 3: Rat Liver Tissue Lysate at 50ugLane 4: Mouse Liver Tissue Lysate at 50ugLane 5: Mouse Lung Tissue Lysate at 50ugLane 6: 22RV1 Whole Cell Lysate at 40ugLane 7: SMMC Whole Cell Lysate at 40ugPredicted bind size: 51KDObserved bind size: 51KD )
Western Blot (WB)
(Anti- ADRA1A Picoband antibody, MBS178268, Western blottingAll lanes: Anti ADRA1A (MBS178268) at 0.5ug/mlLane 1: Rat Cardiac Muscle Tissue Lysate at 50ugLane 2: Rat Brain Tissue Lysate at 50ugLane 3: Rat Liver Tissue Lysate at 50ugLane 4: Mouse Liver Tissue Lysate at 50ugLane 5: Mouse Lung Tissue Lysate at 50ugLane 6: 22RV1 Whole Cell Lysate at 40ugLane 7: SMMC Whole Cell Lysate at 40ugPredicted bind size: 51KDObserved bind size: 51KD )
Related Product Information for anti-ADRA1A antibody
Description: Rabbit IgG polyclonal antibody for Alpha-1A adrenergic receptor(ADRA1A) detection. Tested with WB in Human;Mouse;Rat.
Background: ADRA1A, also known as alpha-1A adrenergic receptor, is an alpha-1 adrenergic receptor, and also denotes the human gene encoding it. This gene is mapped to 8p21.2. Alpha-1-adrenergic receptors are G protein-coupled transmembrane receptors that mediate actions in the sympathetic nervous system through the binding of the catecholamines, epinephrine and norepinephrine. It has been found that ADRA1A transcripts in heart, brain, liver, and prostate. ADRA1A is the predominant ADRA1 subtype in liver and heart, and it can mediate the contraction of prostate smooth muscle.
Background: ADRA1A, also known as alpha-1A adrenergic receptor, is an alpha-1 adrenergic receptor, and also denotes the human gene encoding it. This gene is mapped to 8p21.2. Alpha-1-adrenergic receptors are G protein-coupled transmembrane receptors that mediate actions in the sympathetic nervous system through the binding of the catecholamines, epinephrine and norepinephrine. It has been found that ADRA1A transcripts in heart, brain, liver, and prostate. ADRA1A is the predominant ADRA1 subtype in liver and heart, and it can mediate the contraction of prostate smooth muscle.
References
1. Hirasawa, A., Horie, K., Tanaka, T., Takagaki, K., Murai, M., Yano, J., Tsujimoto, G.Cloning, functional expression and tissue distribution of human cDNA for the alpha-1C-adrenergic receptor. Biochem. Biophys. Res. Commun. 195: 902-909, 1993. 2. Langer SZ (1998). "Nomenclature and state of the art on alpha1-adrenoceptors". Eur. Urol. 33 Suppl 2: 2-6. 3. Weinberg, D. H., Trivedi, P., Tan, C. P., Mitra, S., Perkins-Barrow, A., Borkowski, D., Strader, C. D., Bayne, M. Cloning, expression and characterization of human alpha adrenergic receptors alpha-1A, alpha-1B, and alpha-1C. Biochem. Biophys. Res. Commun. 201: 1296-1304, 1994.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
40,638 Da
NCBI Official Full Name
alpha-1A adrenergic receptor isoform 1
NCBI Official Synonym Full Names
adrenoceptor alpha 1A
NCBI Official Symbol
ADRA1A
NCBI Official Synonym Symbols
ADRA1C; ADRA1L1; ALPHA1AAR
NCBI Protein Information
alpha-1A adrenergic receptor
UniProt Protein Name
Alpha-1A adrenergic receptor
Protein Family
UniProt Gene Name
ADRA1A
UniProt Synonym Gene Names
ADRA1C; Alpha-1A adrenoceptor
UniProt Entry Name
ADA1A_HUMAN
NCBI Description
Alpha-1-adrenergic receptors (alpha-1-ARs) are members of the G protein-coupled receptor superfamily. They activate mitogenic responses and regulate growth and proliferation of many cells. There are 3 alpha-1-AR subtypes: alpha-1A, -1B and -1D, all of which signal through the Gq/11 family of G-proteins and different subtypes show different patterns of activation. This gene encodes alpha-1A-adrenergic receptor. Alternative splicing of this gene generates four transcript variants, which encode four different isoforms with distinct C-termini but having similar ligand binding properties. [provided by RefSeq, Jul 2008]
Uniprot Description
This alpha-adrenergic receptor mediates its action by association with G proteins that activate a phosphatidylinositol-calcium second messenger system. Its effect is mediated by G(q) and G(11) proteins. Nuclear ADRA1A-ADRA1B heterooligomers regulate phenylephrine(PE)-stimulated ERK signaling in cardiac myocytes.
Research Articles on ADRA1A
Similar Products
Product Notes
The ADRA1A adra1a (Catalog #AAA178268) is an Antibody and is intended for research purposes only. The product is available for immediate purchase. The Anti-ADRA1A Antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's ADRA1A can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Western Blot Concentration: 0.1-0.5ug/ml. Researchers should empirically determine the suitability of the ADRA1A adra1a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ADRA1A, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
