Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Anti-SP1 antibody, Western blottingAll lanes: Anti SP1 at 0.5ug/mlWB: HELA Whole Cell Lysate at 40ugPredicted bind size: 81KDObserved bind size: 81KD)

anti-Human SP1 Polyclonal Antibody | anti-SP1 antibody

Anti-SP1 Antibody

Reactivity
Human
Applications
Western Blot
Purity
Immunogen Affinity Purified
Synonyms
SP1; Polyclonal Antibody; Anti-SP1 Antibody; Transcription factor Sp1; SP 1; Sp1 transcription factor; SP1_HUMAN; Specificity protein 1; TSFP 1; TSFP1; anti-SP1 antibody
Ordering
For Research Use Only!
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Immunogen Affinity Purified
Form/Format
Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
737
Applicable Applications for anti-SP1 antibody
Western Blot (WB)
Application Notes
Western Blot Concentration: 0.1-0.5ug/ml
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human SP1 (752-785aa EAICPEGIARLANSGINVMQVADLQSINISGNGF), different from the related mouse and rat sequences by two amino acids.
Ig Type
Rabbit IgG
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Preparation and Storage
At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

Western Blot (WB)

(Anti-SP1 antibody, Western blottingAll lanes: Anti SP1 at 0.5ug/mlWB: HELA Whole Cell Lysate at 40ugPredicted bind size: 81KDObserved bind size: 81KD)

Western Blot (WB) (Anti-SP1 antibody, Western blottingAll lanes: Anti SP1 at 0.5ug/mlWB: HELA Whole Cell Lysate at 40ugPredicted bind size: 81KDObserved bind size: 81KD)
Related Product Information for anti-SP1 antibody
Description: Rabbit IgG polyclonal antibody for Transcription factor Sp1(SP1) detection. Tested with WB in Human.

Background: SP1(transcription factor Sp1), also known as Specificity Protein 1, is a human transcription factor involved in gene expression in the early development of an organism. It belongs to the Sp/KLF family of transcription factors. The protein is 785 amino acids long, with a molecular weight of 81 kDA. By fluorescence in situ hybridization, Matera and Ward (1993) mapped the SP1 gene to 12q13. By in situ hybridization, Gaynor et al. (1993) concluded that 12q13.1 is the most probable location of the SP1 gene. Segmentation in Drosophila is based on a cascade of hierarchical gene interactions initiated by maternally deposited morphogens that define the spatially restricted domains of gap gene expression at blastoderm. The formation of 7 head segments depends on the function of several genes. Wimmer et al. (1993) showed that one of these genes is the Drosophila homolog of the human transcription factor SP1.
References
1. Gaynor, R. B., Shieh, B.-H., Klisak, I., Sparkes, R. S., Lusis, A. J.Localization of the transcription factor SP1 gene to human chromosome 12q12-q13.2.Cytogenet. Cell Genet. 64: 210-212, 1993. 2. Matera, A. G., Ward, D. C.Localization of the human Sp1 transcription factor gene to 12q13 by fluorescence in situ hybridization.Genomics 17: 793-794, 1993. 3. Wimmer, E. A., Jackle, H., Pfeifle, C., Cohen, S. M.A Drosophila homologue of human Sp1 is a head-specific segmentation gene.Nature 366: 690-694, 1993.Wimmer, E. A., Jackle, H., Pfeifle, C., Cohen, S. M.A Drosophila homologue of human Sp1 is a head-specific segmentation gene.Nature 366: 690-694, 1993.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
75,824 Da
NCBI Official Full Name
transcription factor Sp1 isoform c
NCBI Official Synonym Full Names
Sp1 transcription factor
NCBI Official Symbol
SP1
NCBI Protein Information
transcription factor Sp1
UniProt Protein Name
Transcription factor Sp1
UniProt Gene Name
SP1
UniProt Synonym Gene Names
TSFP1
UniProt Entry Name
SP1_HUMAN

NCBI Description

The protein encoded by this gene is a zinc finger transcription factor that binds to GC-rich motifs of many promoters. The encoded protein is involved in many cellular processes, including cell differentiation, cell growth, apoptosis, immune responses, response to DNA damage, and chromatin remodeling. Post-translational modifications such as phosphorylation, acetylation, glycosylation, and proteolytic processing significantly affect the activity of this protein, which can be an activator or a repressor. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Nov 2014]

Uniprot Description

Transcription factor that can activate or repress transcription in response to physiological and pathological stimuli. Binds with high affinity to GC-rich motifs and regulates the expression of a large number of genes involved in a variety of processes such as cell growth, apoptosis, differentiation and immune responses. Highly regulated by post-translational modifications (phosphorylations, sumoylation, proteolytic cleavage, glycosylation and acetylation). Binds also the PDGFR-alpha G-box promoter. May have a role in modulating the cellular response to DNA damage. Implicated in chromatin remodeling. Plays a role in the recruitment of SMARCA4/BRG1 on the c-FOS promoter. Plays an essential role in the regulation of FE65 gene expression. In complex with ATF7IP, maintains telomerase activity in cancer cells by inducing TERT and TERC gene expression. Isoform 3 is a stronger activator of transcription than isoform 1. Positively regulates the transcription of the core clock component ARNTL/BMAL1.

Research Articles on SP1

Similar Products

Product Notes

The SP1 sp1 (Catalog #AAA177927) is an Antibody and is intended for research purposes only. The product is available for immediate purchase. The Anti-SP1 Antibody reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SP1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Western Blot Concentration: 0.1-0.5ug/ml. Researchers should empirically determine the suitability of the SP1 sp1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SP1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.