Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot analysis of CD46 expression in mouse testis extract (lane 1) and NIH3T3 whole cell lysates (lane 2). CD46 at 41KD, 70KD was detected using rabbit anti- CD46 Antigen Affinity purified polyclonal antibody at0.5 ug/mL. The blot was developed using chemiluminescence (ECL) method. )

anti-Mouse CD46 Polyclonal Antibody | anti-CD46 antibody

Anti-CD46 Antibody

Gene Names
Cd46; Mcp
Reactivity
Mouse
Applications
Western Blot
Purity
Immunogen Affinity Purified
Synonyms
CD46; Polyclonal Antibody; Anti-CD46 Antibody; Membrane cofactor protein; AHUS2; Antigen defined by monoclonal; TRA 2 10; Antigen identified by monoclonal; CD46 antigen; CD46 antigen complement regulatory protein; CD46 molecule; CD46 molecule complement regulatory protein; Complement membrane cofactor protein; MCP; MCP_HUMAN; Measles virus receptor; membrane cofactor protein (CD46; trophoblast-lymphocyte cross-reactive antigen); MGC26544; MIC10; TLX; TRA2.10; Trophoblast leucocyte common antigen; Trophoblast leukocyte common antigen; Trophoblast lymphocyte cross reactive antigen; complement regulatory protein; anti-CD46 antibody
Ordering
For Research Use Only!
Reactivity
Mouse
Clonality
Polyclonal
Purity/Purification
Immunogen Affinity Purified
Form/Format
Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
365
Applicable Applications for anti-CD46 antibody
Western Blot (WB)
Application Notes
Western Blot Concentration: 0.1-0.5ug/ml
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of mouse CD46 (46-76aa ELPRPFEAMELKGTPKLFYAVGEKIEYKCKK), different from the related human sequence by twelve amino acids, and from the related rat sequence by nine amino acids.
Ig Type
Rabbit IgG
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Preparation and Storage
At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

Western Blot (WB)

(Western blot analysis of CD46 expression in mouse testis extract (lane 1) and NIH3T3 whole cell lysates (lane 2). CD46 at 41KD, 70KD was detected using rabbit anti- CD46 Antigen Affinity purified polyclonal antibody at0.5 ug/mL. The blot was developed using chemiluminescence (ECL) method. )

Western Blot (WB) (Western blot analysis of CD46 expression in mouse testis extract (lane 1) and NIH3T3 whole cell lysates (lane 2). CD46 at 41KD, 70KD was detected using rabbit anti- CD46 Antigen Affinity purified polyclonal antibody at0.5 ug/mL. The blot was developed using chemiluminescence (ECL) method. )
Related Product Information for anti-CD46 antibody
Description: Rabbit IgG polyclonal antibody for Membrane cofactor protein(CD46) detection. Tested with WB in Mouse.

Background: CD46 complement regulatory protein, also known as CD46 (cluster of differentiation 46) and Membrane Cofactor Protein, is a protein which in humans is encoded by the CD46 gene. The protein encoded by this gene is a type I membrane protein and is a regulatory part of the complement system. And the encoded protein has cofactor activity for inactivation of complement components C3b and C4b by serum factor I, which protects the host cell from damage by complement. In addition, the encoded protein can act as a receptor for the Edmonston strain of measles virus, human herpesvirus-6, and type IV pili of pathogenic Neisseria. Finally, the protein encoded by this gene may be involved in the fusion of the spermatozoa with the oocyte during fertilization. Mutations at this locus have been associated with susceptibility to hemolytic uremic syndrome. Alternatively spliced transcript variants encoding different isoforms have been described. 
References
1. "Entrez Gene: CD46 CD46 molecule, complement regulatory protein". 2. Liszewski MK, Post TW, Atkinson JP (1991). "Membrane cofactor protein (MCP or CD46): newest member of the regulators of complement activation gene cluster".Annu. Rev. Immunol. 9 (1): 431-55. 3. Taylor CT, Biljan MM, Kingsland CR, Johnson PM (May 1994). "Inhibition of human spermatozoon-oocyte interaction in vitro by monoclonal antibodies to CD46 (membrane cofactor protein)". Hum. Reprod.9 (5): 907-11.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
33,495 Da
NCBI Official Full Name
membrane cofactor protein
NCBI Official Synonym Full Names
CD46 antigen, complement regulatory protein
NCBI Official Symbol
Cd46
NCBI Official Synonym Symbols
Mcp
NCBI Protein Information
membrane cofactor protein
UniProt Protein Name
Membrane cofactor protein
Protein Family
UniProt Gene Name
Cd46
UniProt Synonym Gene Names
Mcp
UniProt Entry Name
MCP_MOUSE

Uniprot Description

CD46: Acts as a cofactor for complement factor I, a serine protease which protects autologous cells against complement- mediated injury by cleaving C3b and C4b deposited on host tissue. May be involved in the fusion of the spermatozoa with the oocyte during fertilization. Also acts as a costimulatory factor for T- cells which induces the differentiation of CD4+ into T-regulatory 1 cells. T-regulatory 1 cells suppress immune responses by secreting interleukin-10, and therefore are thought to prevent autoimmunity. A number of viral and bacterial pathogens seem to exploit this property and directly induce an immunosuppressive phenotype in T-cells by binding to CD46. Defects in CD46 are a cause of susceptibility to hemolytic uremic syndrome atypical type 2 (AHUS2). An atypical form of hemolytic uremic syndrome. It is a complex genetic disease characterized by microangiopathic hemolytic anemia, thrombocytopenia, renal failure and absence of episodes of enterocolitis and diarrhea. In contrast to typical hemolytic uremic syndrome, atypical forms have a poorer prognosis, with higher death rates and frequent progression to end-stage renal disease. Susceptibility to the development of atypical hemolytic uremic syndrome can be conferred by mutations in various components of or regulatory factors in the complement cascade system. Other genes may play a role in modifying the phenotype. Patients with CD46 mutations seem to have an overall better prognosis compared to patients carrying CFH mutations. 16 isoforms of the human protein are produced by alternative splicing.

Protein type: Receptor, misc.; Membrane protein, integral; Cell surface

Cellular Component: acrosome; basolateral plasma membrane; cell surface; cytoplasm; cytoplasmic vesicle; extracellular region; focal adhesion; Golgi apparatus; inner acrosomal membrane; integral to membrane; membrane; plasma membrane

Molecular Function: cadherin binding; complement binding; endopeptidase activity; enzyme inhibitor activity

Biological Process: interleukin-10 production; negative regulation of catalytic activity; negative regulation of complement activation; positive regulation of interleukin-10 production; positive regulation of memory T cell differentiation; positive regulation of regulatory T cell differentiation; positive regulation of T cell proliferation; proteolysis; regulation of Notch signaling pathway; single fertilization; T cell mediated immunity

Research Articles on CD46

Similar Products

Product Notes

The CD46 cd46 (Catalog #AAA177909) is an Antibody and is intended for research purposes only. The product is available for immediate purchase. The Anti-CD46 Antibody reacts with Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's CD46 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Western Blot Concentration: 0.1-0.5ug/ml. Researchers should empirically determine the suitability of the CD46 cd46 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CD46, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.