DARPP32 Polyclonal Antibody | anti-DARPP32 antibody

Anti-DARPP32 Antibody

Cat. Num. AAA177854

• Gene Names: PPP1R1B; DARPP32; DARPP-32
• Reactivity: Human, Mouse, Rat
• Applications: Western Blot, Immunohistochemistry
• Purity: Immunogen Affinity Purified
• Synonyms: DARPP32; Polyclonal Antibody; Anti-DARPP32 Antibody; Protein phosphatase 1 regulatory subunit 1B; DARPP 32; DARPP-32; Dopamine and cAMP regulated neuronal phosphoprotein 32; Dopamine and cAMP regulated neuronal phosphoprotein; Dopamine and cAMP regulated phosphoprotein; Dopamine and cAMP regulated phosphoprotein DARPP 32; Dopamine and cAMP regulated phosphoprotein DARPP32; Dopamine- and cAMP-regulated neuronal phosphoprotein; FLJ20940; IPPD; Neuronal phosphoprotein DARPP 32; PPP1R1B; PPR1B_HUMAN; Protein phosphatase 1 regulatory (inhibitor) subunit 1B; protein phosphatase 1 regulatory inhibitor subunit 1B; anti-DARPP32 antibody

• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Purity/Purification: Immunogen Affinity Purified
• Form/Format: Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
• Sequence Length: 168

• Applicable Applications for anti-DARPP32 antibody: Western Blot (WB), Immunohistochemistry (IHC) Paraffin
• Application Notes: Western Blot Concentration: 0.1-0.5ug/ml; Immunohistochemistry (IHC) Paraffin Concentration: 0.5-1ug/ml
• Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human DARPP32 (1-36aa MDPKDRKKIQFSVPAPPSQLDPRQVEMIRRRRPTPA), identical to the related mouse and rat sequences.
• Ig Type: Rabbit IgG
• Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Preparation and Storage: At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

Western Blot (WB)

(Western blot analysis of DARPP32 expression in rat brain extract (lane 1), SW620 whole cell lysates (lane 2), 22RV1 whole cell lysates (lane 3) and HELA whole cell lysates (lane 4). DARPP32 at 34KD, 39KD was detected using rabbit anti- DARPP32 Antigen Affinity purified polyclonal antibody at0.5ug/mL. The blot was developed using chemiluminescence (ECL) method. )

Immunohistochemistry (IHC)

(DARPP32 was detected in paraffin-embedded sections of mouse pancreas tissues using rabbit anti- DARPP32 Antigen Affinity purified polyclonal antibody at 1 ug/mL. The immunohistochemical section was developed using SABC method. )

Immunohistochemistry (IHC)

(DARPP32 was detected in paraffin-embedded sections of rat intestine tissues using rabbit anti- DARPP32 Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method. )

Immunohistochemistry (IHC)

(DARPP32 was detected in paraffin-embedded sections of human lung cancer tissues using rabbit anti- DARPP32 Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method. )

Related Product Information for anti-DARPP32 antibody

Description: Rabbit IgG polyclonal antibody for Protein phosphatase 1 regulatory subunit 1B(PPP1R1B) detection. Tested with WB, IHC-P in Human;Mouse;Rat.

Background: Protein phosphatase 1 regulatory subunit 1B (PPP1R1B), also known as dopamine- and cAMP-regulated neuronal phosphoprotein (DARPP-32), is a protein that in humans is encoded by the PPP1R1B gene. This gene encodes a bifunctional signal transduction molecule. Dopaminergic and glutamatergic receptor stimulation regulates its phosphorylation and function as a kinase or phosphatase inhibitor. As a target for dopamine, this gene may serve as a therapeutic target for neurologic and psychiatric disorders. Multiple transcript variants encoding different isoforms have been found for this gene.

References

1. "Entrez Gene: PPP1R1B protein phosphatase 1, regulatory (inhibitor) subunit 1B (dopamine and cAMP regulated phosphoprotein, DARPP-32)". 2. Brené S, Lindefors N, Ehrlich M, Taubes T, Horiuchi A, Kopp J, Hall H, Sedvall G, Greengard P, Persson H (March 1994). "Expression of mRNAs encoding ARPP-16/19, ARPP-21, and DARPP-32 in human brain tissue". J. Neurosci. 14 (3 Pt 1): 985-98. 3. Ouimet CC, Greengard P (February 1990). "Distribution of DARPP-32 in the basal ganglia: an electron microscopic study". J. Neurocytol. 19 (1): 39-52.

NCBI and Uniprot Product Information

• NCBI GI #: 335057524
• NCBI GeneID: 84152
• NCBI Accession #: NP_001229393.1
• NCBI GenBank Nucleotide #: NM_001242464.1
• UniProt Accession #: Q9UD71; Q547V9; Q547W0; Q9H7G1
• Molecular Weight: 18,738 Da
• NCBI Official Full Name: protein phosphatase 1 regulatory subunit 1B isoform 2
• NCBI Official Synonym Full Names: protein phosphatase 1 regulatory inhibitor subunit 1B
• NCBI Official Symbol: PPP1R1B
• NCBI Official Synonym Symbols: DARPP32; DARPP-32
• NCBI Protein Information: protein phosphatase 1 regulatory subunit 1B
• UniProt Protein Name: Protein phosphatase 1 regulatory subunit 1B
• UniProt Gene Name: PPP1R1B
• UniProt Synonym Gene Names: DARPP32
• UniProt Entry Name: PPR1B_HUMAN

NCBI Description

This gene encodes a bifunctional signal transduction molecule. Dopaminergic and glutamatergic receptor stimulation regulates its phosphorylation and function as a kinase or phosphatase inhibitor. As a target for dopamine, this gene may serve as a therapeutic target for neurologic and psychiatric disorders. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2011]

Uniprot Description

DARPP-32: a member of the protein phosphatase inhibitor 1 family. A dopamine- and cyclic AMP-regulated neuronal phosphoprotein. Both dopaminergic and glutamatergic (NMDA) receptor stimulation regulate the extent of DARPP32 phosphorylation, but in opposite directions. Dopamine D1 receptor stimulation enhances cAMP formation, resulting in the phosphorylation of DARPP32; phosphorylated DARPP32 is a potent protein phosphatase-1 inhibitor. NMDA receptor stimulation elevates intracellular calcium, which leads to activation of calcineurin and dephosphorylation of phospho-DARPP32, thereby reducing the phosphatase-1 inhibitory activity of DARPP32. Two alternatively-spliced isoforms have been described.

Protein type: Protein phosphatase, regulatory subunit; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 17q12

Cellular Component: cell soma; cytoplasm; cytosol; nucleus

Molecular Function: cAMP-dependent protein kinase inhibitor activity; D1 dopamine receptor binding; D2 dopamine receptor binding; D3 dopamine receptor binding; D4 dopamine receptor binding; D5 dopamine receptor binding; protein binding; protein kinase inhibitor activity; protein phosphatase inhibitor activity; protein phosphatase type 1 regulator activity; type 1 serine/threonine specific protein phosphatase inhibitor activity

Biological Process: negative regulation of catalytic activity; negative regulation of female receptivity; negative regulation of protein kinase activity; regulation of catalytic activity; response to amphetamine; signal transduction; transcription, DNA-dependent; visual learning