UBA1 Polyclonal Antibody | anti-UBA1 antibody

Anti-UBA1 Antibody

Cat. Num. AAA177744

• Gene Names: UBA1; A1S9; A1ST; GXP1; UBE1; A1S9T; AMCX1; POC20; SMAX2; UBA1A; UBE1X; CFAP124
• Reactivity: Human, Mouse, Rat
• Applications: Western Blot
• Purity: Immunogen Affinity Purified
• Synonyms: UBA1; Polyclonal Antibody; Anti-UBA1 Antibody; Ubiquitin-like modifier-activating enzyme 1; A1S9; A1S9 protein; A1S9T and BN75 temperature sensitivity complementing; A1S9T; A1ST; AMCX1; CFAP124; CTD-2522E6.1; GXP 1; GXP1; MGC4781; POC20; POC20 centriolar protein homolog; Protein A1S9; SMAX2; Uba1; ubiquitin-activating enzyme E1 homolog A; UBA1_HUMAN; UBA1A; UBE 1; UBE 1X; UBE1; UBE1X; Ubiquitin activating enzyme E1; Ubiquitin-activating enzyme E1; ubiquitin like modifier activating enzyme 1; anti-UBA1 antibody

• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Specificity: No cross reactivity with other proteins.
• Purity/Purification: Immunogen Affinity Purified
• Form/Format: Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na₂HPO₄, 0.05mg NaN₃.
• Sequence Length: 1058

• Applicable Applications for anti-UBA1 antibody: Western Blot (WB)
• Application Notes: Western Blot ; ; Concentration 0.1-0.5ug/ml; Tested Species: Hu, Ms, Rat.; ; ; Tested Species: In-house tested species with positive results.; ; Other applications have not been tested; ; Optimal dilutions should be determined by en users.
• Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human UBA1 (102-139aa HDQGTAQWADLSSQFYLREEDIGKNRAEVSQPRLAELN), different from the related mouse and rat sequences by one amino acid.
• Ig Type: Rabbit IgG
• Reconstitution: 0.2ml of distilled water will yield a concentration of 500 ug/ml.
• Preparation and Storage: At -20°C for one year. After reconstitution, at 4°C for one month. It can also be aliquoted and stored frozen at -20°C for a longer time. Avoid repeated freezing and thawing.

Western Blot (WB)

(Western blot analysis of UBA1 expression in rat liver extract (lane 1), mouse liver extract (lane 2), mouse testis extract (lane 3) and HELA whole cell lysates (lane 4). UBA1 at 117KD was detected using rabbit anti- UBA1 Antigen Affinity purified polyclonal antibody at0.5 ug/mL. The blot was developed using chemiluminescence (ECL) method. )

Related Product Information for anti-UBA1 antibody

Ubiquitin-like modifier activating enzyme 1 (UBA1) is an enzyme which in humans is encoded by the UBA1 gene. The protein encoded by this gene catalyzes the first step in ubiquitin conjugation, or ubiquitination, to mark cellular proteins for degradation. Specifically, UBA1 catalyzes the ATP-dependent adenylation of ubiquitin (Ub), thereby forming a thioester bond between the two. It also continues to participate in subsequent steps of ubiquination as a Ub carrier. UBA1 is one of only two human ubiquitin-activating enzymes (E1), the other being UBA6, and thus is largely responsible for protein ubiquitination in humans. Through its central role in ubiquitination, UBA1 has been linked to cell cycle regulation, endocytosis, signal transduction, apoptosis, DNA damage repair, and transcriptional regulation. Additionally, UBE1 helps regulate the NEDD8 pathway, thus implicating it in protein folding, as well as mitigating the depletion of ubiquitin levels during stress.

References

1. "Entrez Gene: ubiquitin-like modifier activating enzyme 1". 2. Moudry P, Lukas C, Macurek L, Hanzlikova H, Hodny Z, Lukas J, Bartek J (Apr 2012). "Ubiquitin-activating enzyme UBA1 is required for cellular response to DNA damage". Cell Cycle 11 (8): 1573-82.

NCBI and Uniprot Product Information

• NCBI GI #: 23510338
• NCBI GeneID: 7317
• NCBI Accession #: NP_003325.2
• NCBI GenBank Nucleotide #: NM_003334.3
• UniProt Accession #: P22314; Q5JRR8; Q96E13
• NCBI Official Full Name: ubiquitin-like modifier-activating enzyme 1
• NCBI Official Synonym Full Names: ubiquitin like modifier activating enzyme 1
• NCBI Official Symbol: UBA1
• NCBI Official Synonym Symbols: A1S9; A1ST; GXP1; UBE1; A1S9T; AMCX1; POC20; SMAX2; UBA1A; UBE1X; CFAP124
• NCBI Protein Information: ubiquitin-like modifier-activating enzyme 1
• UniProt Protein Name: Ubiquitin-like modifier-activating enzyme 1
• Protein Family: Ubiquitin-activating enzyme
• UniProt Gene Name: UBA1
• UniProt Synonym Gene Names: A1S9T; UBE1
• UniProt Entry Name: UBA1_HUMAN

NCBI Description

The protein encoded by this gene catalyzes the first step in ubiquitin conjugation to mark cellular proteins for degradation. This gene complements an X-linked mouse temperature-sensitive defect in DNA synthesis, and thus may function in DNA repair. It is part of a gene cluster on chromosome Xp11.23. Alternatively spliced transcript variants that encode the same protein have been described. [provided by RefSeq, Jul 2008]

Uniprot Description

UBE1: an enzyme of the ubiquitin-activating E1 family. Adenylates ubiquitin at its carboxy-terminal glycine residue and thereafter links this residue to the side chain of a cysteine residue in E1, yielding an ubiquitin-E1 thiolester. There are two active sites within the E1 molecule, allowing it to accomodate two ubiquitin moieties at a time, with a new ubiquitin forming an adenylate intermediate as the previous one is transferred to the thiol site. Complements an X-linked mouse temperature-sensitive defect in DNA synthesis, and thus may function in DNA repair.

Protein type: Ubiquitin conjugating system; Ubiquitin ligase; EC 6.3.2.19

Chromosomal Location of Human Ortholog: Xp11.23

Cellular Component: cytoplasm; cytosol; desmosome; endosome membrane; heterochromatin; lysosomal membrane; mitochondrion; nucleus; rough endoplasmic reticulum membrane

Molecular Function: ATP binding; protein binding; ubiquitin activating enzyme activity; ubiquitin-protein ligase activity

Biological Process: modification-dependent protein catabolic process; protein ubiquitination; response to DNA damage stimulus

Disease: Spinal Muscular Atrophy, X-linked 2