Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Anti-Bmi1 Picoband antibody, MBS177432-1.jpgAll lanes: Anti BMI1 (MBS177432) at 0.5ug/mlWB: Recombinant Human BMI1 Protein 0.5ngPredicted bind size: 37KDObserved bind size: 37KD )

Rabbit Polycomb complex protein BMI-1 Polyclonal Antibody | anti-BMI1 antibody

Anti-Bmi1 Antibody

Reactivity
Human, Mouse, Rat. No cross reactivity with other proteins.
Applications
Western Blot
Purity
Immunogen affinity purified.
Synonyms
Polycomb complex protein BMI-1; Polyclonal Antibody; Anti-Bmi1 Antibody; B lymphoma Mo MLV insertion region (mouse) antibody; B lymphoma Mo MLV insertion region 1 homolog antibody; Bmi 1 antibody; BMI1 antibody; BMI1 polycomb ring finger oncogene antibody; BMI1_HUMAN antibody; Flvi 2/bmi 1 antibody; FLVI2/BMI1 antibody; MGC12685 antibody; Murine leukemia viral (bmi 1) oncogene homolog antibody; Oncogene BMI 1 antibody; PCGF 4 antibody; PCGF4 antibody; Polycomb complex protein BMI 1 antibody; Polycomb complex protein BMI-1 antibody; Polycomb group protein Bmi1 antibody; Polycomb group ring finger 4 antibody; Polycomb group RING finger protein 4 antibody; RING finger protein 51 antibody; RNF 51 antibody; RNF51 antibody; BMI1 proto-oncogene; polycomb ring finger; anti-BMI1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse, Rat. No cross reactivity with other proteins.
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Immunogen affinity purified.
Form/Format
Lyophilized
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg Thimerosal, 0.05mg NaN3.
Sequence Length
469
Applicable Applications for anti-BMI1 antibody
Western Blot (WB)
Application Notes
Western Blot: Concentration: 0.1-0.5mug/ml; Tested Species: Human, Mouse, Rat
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Immunogen
A synthetic peptide corresponding to a sequence in the middle region of human Bmi1(135-165aa IEFFDQNRLDRKVNKDKEKSKEEVNDKRYLR), different from the related mouse sequence by four amino acids.
Preparation and Storage
At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

Testing Data

(Anti-Bmi1 Picoband antibody, MBS177432-1.jpgAll lanes: Anti BMI1 (MBS177432) at 0.5ug/mlWB: Recombinant Human BMI1 Protein 0.5ngPredicted bind size: 37KDObserved bind size: 37KD )

Testing Data (Anti-Bmi1 Picoband antibody, MBS177432-1.jpgAll lanes: Anti BMI1 (MBS177432) at 0.5ug/mlWB: Recombinant Human BMI1 Protein 0.5ngPredicted bind size: 37KDObserved bind size: 37KD )

Testing Data

(Anti-Bmi1 Picoband antibody, MBS177432-2.jpgAll lanes: Anti BMI1 (MBS177432) at 0.5ug/mlLane 1: Rat Spleen Tissue Lysate at 50ugLane 2: HT1080 Whole Cell Lysate at 40ugLane 3: HELA Whole Cell Lysate at 40ugPredicted bind size: 37KDObserved bind size: 37KD )

Testing Data (Anti-Bmi1 Picoband antibody, MBS177432-2.jpgAll lanes: Anti BMI1 (MBS177432) at 0.5ug/mlLane 1: Rat Spleen Tissue Lysate at 50ugLane 2: HT1080 Whole Cell Lysate at 40ugLane 3: HELA Whole Cell Lysate at 40ugPredicted bind size: 37KDObserved bind size: 37KD )
Related Product Information for anti-BMI1 antibody
Description: Rabbit IgG polyclonal antibody for Polycomb complex protein BMI-1(BMI1) detection. Tested with WB in Human;Mouse;Rat.
Background: BMI1(BMI1 polycomb ring finger oncogene), also known as RNF51, is a protein which in humans is encoded by the BMI1 gene. The Bmi1 gene is highly conserved in evolution as indicated by zoo blot hybridization with Bmi1 probes corresponding to the protein-encoding domain. By fluorescence in situ hybridization, the human BMI1 gene is assigned to chromosome 10p13. BMI1 has a key role in regulating the proliferative activity of normal stem and progenitor cells. Most importantly, they provided evidence that the proliferative potential of leukemic stem and progenitor cells lacking BMI1 is compromised because they eventually undergo proliferation arrest and show signs of differentiation and apoptosis, leading to transplant failure of the leukemia. Complementation studies showed that BMI1 completely rescues these proliferative defects. Deletion analysis showed that the RING finger and helix-turn-helix domains of BMI1 were required for life span extension and repression of the tumor suppressor p16(INK4). BMI1 selectively extended the life span of these cultures. Confocal microscopy showed that BMI1 transiently colocalized with centromeres during interphase in HeLa cells.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
36,949 Da
NCBI Official Full Name
COMMD3-BMI1 read-through protein
NCBI Official Synonym Full Names
COMMD3-BMI1 readthrough
NCBI Official Symbol
COMMD3-BMI1
NCBI Protein Information
COMMD3-BMI1 read-through protein
UniProt Protein Name
Polycomb complex protein BMI-1
Protein Family
UniProt Gene Name
BMI1
UniProt Synonym Gene Names
PCGF4; RNF51
UniProt Entry Name
BMI1_HUMAN

NCBI Description

This locus represents naturally occurring read-through transcription between the neighboring COMM domain-containing protein 3 and polycomb complex protein BMI-1 genes on chromosome 10. The read-through transcript produces a fusion protein that shares sequence identity with each individual gene product. [provided by RefSeq, Feb 2011]

Uniprot Description

BMI1: Component of a Polycomb group (PcG) multiprotein PRC1- like complex, a complex class required to maintain the transcriptionally repressive state of many genes, including Hox genes, throughout development. PcG PRC1 complex acts via chromatin remodeling and modification of histones; it mediates monoubiquitination of histone H2A 'Lys-119', rendering chromatin heritably changed in its expressibility. In the PRC1 complex, it is required to stimulate the E3 ubiquitin-protein ligase activity of RNF2/RING2. Component of a PRC1-like complex. Interacts with RING1 and RING2. Interacts vwith CBX7 and CBX8. Interacts with SPOP. Part of a complex consisting of BMI1, CUL3 and SPOP. Interacts with E4F1.

Protein type: Ligase; Motility/polarity/chemotaxis; EC 6.3.2.-; Oncoprotein; Ubiquitin conjugating system; Ubiquitin ligase

Chromosomal Location of Human Ortholog: 10p11.23

Cellular Component: nucleoplasm; heterochromatin; nuclear body; cytoplasm; PcG protein complex; nucleus; ubiquitin ligase complex

Molecular Function: protein binding; zinc ion binding; sequence-specific DNA binding; ubiquitin-protein ligase activity; chromatin binding

Biological Process: transcription, DNA-dependent; in utero embryonic development; positive regulation of immature T cell proliferation in the thymus; negative regulation of transcription from RNA polymerase II promoter; humoral immune response; embryonic skeletal morphogenesis; segment specification; rostrocaudal neural tube patterning; positive regulation of fibroblast proliferation; regulation of gene expression; positive regulation of ubiquitin-protein ligase activity; histone ubiquitination; positive regulation of B cell proliferation; DNA methylation; somatic stem cell division; hemopoiesis; brain development; histone acetylation

Similar Products

Product Notes

The BMI1 bmi1 (Catalog #AAA177432) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Anti-Bmi1 Antibody reacts with Human, Mouse, Rat. No cross reactivity with other proteins. and may cross-react with other species as described in the data sheet. AAA Biotech's Polycomb complex protein BMI-1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Western Blot: Concentration: 0.1-0.5mug/ml; Tested Species: Human, Mouse, Rat. Researchers should empirically determine the suitability of the BMI1 bmi1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Polycomb complex protein BMI-1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.