Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Figure 1. Western blot analysis of ELAVL2 HuB using anti-ELAVL2 HuB antibody.Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel)/90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.Lane 1: human T-47D whole cell lysate,Lane 2: human A549 whole cell lysate,Lane 3: human Caco-2 whole cell lysate.After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-ELAVL2 HuB antigen affinity purified polyclonal antibody at 0.5 ug/ml overnight at 4 degree C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for ELAVL2 HuB at approximately 45KD. The expected band size for ELAVL2 HuB is at 40KD.)

Rabbit ELAVL2 HuB Polyclonal Antibody | anti-ELAVL2 antibody

Anti-ELAVL2 HuB Antibody

Gene Names
ELAVL2; HUB; HELN1; HEL-N1
Reactivity
Human, Mouse, Rat
Applications
Western Blot, Immunohistochemistry
Purity
Immunogen Affinity Purified
Synonyms
ELAVL2 HuB; Polyclonal Antibody; Anti-ELAVL2 HuB Antibody; ELAV-like protein 2; ELAV-like neuronal protein 1; Hu-antigen B; HuB; Nervous system-specific RNA-binding protein Hel-N1; ELAVL2; HUB; ELAV like RNA binding protein 2; anti-ELAVL2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Specificity
No cross reactivity with other proteins.
Purity/Purification
Immunogen Affinity Purified
Form/Format
Lyophilized
Sequence Length
346
Applicable Applications for anti-ELAVL2 antibody
Western Blot (WB), Immunohistochemistry (IHC) Paraffin
Application Notes
WB: 0.1-0.5 mug/ml
IHC-P: 0.5-1 mug/ml
Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections.
Immunogen
A synthetic peptide corresponding to a sequence of human ELAVL2 HuB (METQLSNGPTCNNTANGPTTINNNCSSPVDSGNTEDSK).
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Relevant Detection Systems
It is recommended to use an Enhanced Chemiluminescent Kit with anti-Rabbit IgG (MBS176460) for Western blot, and HRP Conjugated anti-Rabbit IgG Super Vision Assay Kit (MBS176453) for IHC-P.
Preparation and Storage
Store at -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for a longer time.
Avoid repeated freezing and thawing.

Western Blot (WB)

(Figure 1. Western blot analysis of ELAVL2 HuB using anti-ELAVL2 HuB antibody.Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel)/90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.Lane 1: human T-47D whole cell lysate,Lane 2: human A549 whole cell lysate,Lane 3: human Caco-2 whole cell lysate.After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-ELAVL2 HuB antigen affinity purified polyclonal antibody at 0.5 ug/ml overnight at 4 degree C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for ELAVL2 HuB at approximately 45KD. The expected band size for ELAVL2 HuB is at 40KD.)

Western Blot (WB) (Figure 1. Western blot analysis of ELAVL2 HuB using anti-ELAVL2 HuB antibody.Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel)/90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.Lane 1: human T-47D whole cell lysate,Lane 2: human A549 whole cell lysate,Lane 3: human Caco-2 whole cell lysate.After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-ELAVL2 HuB antigen affinity purified polyclonal antibody at 0.5 ug/ml overnight at 4 degree C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for ELAVL2 HuB at approximately 45KD. The expected band size for ELAVL2 HuB is at 40KD.)

Immunohistochemistry (IHC)

(Figure 3. IHC analysis of ELAVL2 HuB using anti-ELAVL2 HuB antibody.ELAVL2 HuB was detected in paraffin-embedded section of mouse brain tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1ug/ml rabbit anti-ELAVL2 HuB antibody.ELAVL2 HuB was detected in paraffin-embedded section of mouse brain tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1ug/ml rabbit anti-ELAVL2 HuB antibody.ELAVL2 HuB was detected in paraffin-embedded section of mouse brain tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1ug/ml rabbit anti-ELAVL2 HuB antibody.ELAVL2 HuB was detected in paraffin-embedded section of human glioma tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1ug/ml rabbit anti-ELAVL2 HuB Antibody overnight at 4 degree C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.)

Immunohistochemistry (IHC) (Figure 3. IHC analysis of ELAVL2 HuB using anti-ELAVL2 HuB antibody.ELAVL2 HuB was detected in paraffin-embedded section of mouse brain tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1ug/ml rabbit anti-ELAVL2 HuB antibody.ELAVL2 HuB was detected in paraffin-embedded section of mouse brain tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1ug/ml rabbit anti-ELAVL2 HuB antibody.ELAVL2 HuB was detected in paraffin-embedded section of mouse brain tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1ug/ml rabbit anti-ELAVL2 HuB antibody.ELAVL2 HuB was detected in paraffin-embedded section of human glioma tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1ug/ml rabbit anti-ELAVL2 HuB Antibody overnight at 4 degree C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.)
Related Product Information for anti-ELAVL2 antibody
Description: Rabbit IgG polyclonal antibody for ELAVL2 HuB detection. Tested with WB, IHC-P in Human; Mouse; Rat.
Background: ELAV-like protein 2 is a protein that in humans is encoded by the ELAVL2 gene. This gene encodes a member of the cytochrome P450 superfamily of enzymes, and is commonly known as sterol 27-hydroxylase. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This mitochondrial protein oxidizes cholesterol intermediates as part of the bile synthesis pathway. Since the conversion of cholesterol to bile acids is the major route for removing cholesterol from the body, this protein is important for overall cholesterol homeostasis. Mutations in this gene cause cerebrotendinous xanthomatosis, a rare autosomal recessive lipid storage disease.
References
1. Guyant-Marechal, L., Verrips, A., Girard, C., Wevers, R. A., Zijlstra, F., Sistermans, E., Vera, P., Campion, D., Hannequin, D. Unusual cerebrotendinous xanthomatosis with fronto-temporal dementia phenotype. Am. J. Med. Genet. 139A: 114-117, 2005. 2. Lamon-Fava, S., Schaefer, E. J., Garuti, R., Salen, G., Calandra, S. Two novel mutations in the sterol 27-hydroxylase gene causing cerebrotendinous xanthomatosis. Clin. Genet. 61: 185-191, 2002.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
38,015 Da
NCBI Official Full Name
ELAV-like protein 2 isoform b
NCBI Official Synonym Full Names
ELAV like RNA binding protein 2
NCBI Official Symbol
ELAVL2
NCBI Official Synonym Symbols
HUB; HELN1; HEL-N1
NCBI Protein Information
ELAV-like protein 2
UniProt Protein Name
ELAV-like protein 2
Protein Family
UniProt Gene Name
ELAVL2
UniProt Synonym Gene Names
HUB; HuB

NCBI Description

The protein encoded by this gene is a neural-specific RNA-binding protein that is known to bind to several 3' UTRs, including its own and also that of FOS and ID. The encoded protein may recognize a GAAA motif in the RNA. Three transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq, Jan 2010]

Uniprot Description

Binds RNA. Seems to recognize a GAAA motif. Can bind to its own 3'-UTR, the FOS 3'-UTR and the ID 3'-UTR.

Research Articles on ELAVL2

Similar Products

Product Notes

The ELAVL2 elavl2 (Catalog #AAA1751501) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Anti-ELAVL2 HuB Antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's ELAVL2 HuB can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunohistochemistry (IHC) Paraffin. WB: 0.1-0.5 mug/ml IHC-P: 0.5-1 mug/ml Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Researchers should empirically determine the suitability of the ELAVL2 elavl2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ELAVL2 HuB, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.