Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Figure 1. Western blot analysis of MAdCAM1 using anti-MAdCAM1 antibody. Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel)/90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions. Lane 1: human 293T whole cell lysate,Lane 2: human A375 whole cell lysate,Lane 3: human K562 whole cell lysate. After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-MAdCAM1 antigen affinity purified polyclonal antibody at 0.5 ug/ml overnight at 4 degree C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for MAdCAM1 at approximately 43KD. The expected band size for MAdCAM1 is at 40KD.)

Rabbit anti-Human MAdCAM1 Polyclonal Antibody | anti-MAdCAM1 antibody

Anti-MAdCAM1 Antibody

Gene Names
MADCAM1; MACAM1
Reactivity
Human
Applications
Western Blot
Purity
Immunogen Affinity Purified
Synonyms
MAdCAM1; Polyclonal Antibody; Anti-MAdCAM1 Antibody; Mucosal addressin cell adhesion molecule 1; MAdCAM-1; hMAdCAM-1; MADCAM1; Mucosal vascular addressin cell adhesion molecule 1; anti-MAdCAM1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
No cross reactivity with other proteins.
Purity/Purification
Immunogen Affinity Purified
Form/Format
Lyophilized
Sequence Length
271
Applicable Applications for anti-MAdCAM1 antibody
Western Blot (WB)
Application Notes
WB: 0.1-0.5 mug/ml
Tested Species: In-house tested species with positive results.
Immunogen
A synthetic peptide corresponding to a sequence of human MAdCAM1 (QELEGAQALGPEVQEEEEEPQGDEDVLFRVTERWRL).
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Relevant Detection Systems
It is recommended to use an Enhanced Chemiluminescent Kit with anti-Rabbit IgG (MBS176460) for Western blot.
Preparation and Storage
Store at -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for a longer time.
Avoid repeated freezing and thawing.

Western Blot (WB)

(Figure 1. Western blot analysis of MAdCAM1 using anti-MAdCAM1 antibody. Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel)/90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions. Lane 1: human 293T whole cell lysate,Lane 2: human A375 whole cell lysate,Lane 3: human K562 whole cell lysate. After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-MAdCAM1 antigen affinity purified polyclonal antibody at 0.5 ug/ml overnight at 4 degree C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for MAdCAM1 at approximately 43KD. The expected band size for MAdCAM1 is at 40KD.)

Western Blot (WB) (Figure 1. Western blot analysis of MAdCAM1 using anti-MAdCAM1 antibody. Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel)/90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions. Lane 1: human 293T whole cell lysate,Lane 2: human A375 whole cell lysate,Lane 3: human K562 whole cell lysate. After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-MAdCAM1 antigen affinity purified polyclonal antibody at 0.5 ug/ml overnight at 4 degree C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for MAdCAM1 at approximately 43KD. The expected band size for MAdCAM1 is at 40KD.)
Related Product Information for anti-MAdCAM1 antibody
Description: Rabbit IgG polyclonal antibody for MAdCAM1 detection. Tested with WB in Human.
Background: MADCAM1 (Mucosal Vascular Addressin Cell Adhesion Molecule 1), also known as MACAM1, is a protein that in humans is encoded by the MADCAM1 gene. By PCR-based analysis of somatic cell hybrids, this gene is mapped to chromosome 19. The protein encoded by this gene is an endothelil cell adhesion molecule that interacts preferentially with the leukocyte beta7 integrin LPAM-1 (alpha4/beta7), L-selectin, and VLA-4 (alpha4/beta1) on myeloid cells to direct leukocytes into mucosal and inflamed tissues. It is a member of the immunoglobulin superfamily and is similar to ICAM-1 and VCAM-1.
References
1. Briskin, M. J., McEvoy, L. M., Butcher, E. C. MAdCAM-1 has homology to immunoglobulin and mucin-like adhesion receptors and to IgA1. Nature 363: 461-464, 1993. 2. Entrez Gene: mucosal vascular addressin cell adhesion molecule 1. 3. Leung, E., Berg, R. W., Langley, R., Greene, J., Raymond, L. A., Augustus, M., Ni, J., Carter, K. C., Spurr, N., Choo, K. H. A., Krissansen, G. W. Genomic organization, chromosomal mapping, and analysis of the 5-prime promoter region of the human MAdCAM-1 gene. Immunogenetics 46: 111-119, 1997.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
28,705 Da
NCBI Official Full Name
mucosal addressin cell adhesion molecule 1 isoform a
NCBI Official Synonym Full Names
mucosal vascular addressin cell adhesion molecule 1
NCBI Official Symbol
MADCAM1
NCBI Official Synonym Symbols
MACAM1
NCBI Protein Information
mucosal addressin cell adhesion molecule 1
UniProt Protein Name
Mucosal addressin cell adhesion molecule 1
UniProt Gene Name
MADCAM1
UniProt Synonym Gene Names
MAdCAM-1; hMAdCAM-1

NCBI Description

The protein encoded by this gene is an endothelial cell adhesion molecule that interacts preferentially with the leukocyte beta7 integrin LPAM-1 (alpha4beta7), L-selectin, and VLA-4 (alpha4beta1) on myeloid cells to direct leukocytes into mucosal and inflamed tissues. It is a member of the immunoglobulin family and is similar to ICAM1 and VCAM1. At least seven alternatively spliced transcripts encoding different protein isoforms have been found for this gene, but the full-length nature of some variants has not been determined. [provided by RefSeq, Jul 2008]

Uniprot Description

Cell adhesion leukocyte receptor expressed by mucosal venules, helps to direct lymphocyte traffic into mucosal tissues including the Peyer patches and the intestinal lamina propria. It can bind both integrin alpha-4/beta-7 and L-selectin, regulating both the passage and retention of leukocytes. Isoform 2, lacking the mucin-like domain, may be specialized in supporting integrin alpha-4/beta-7-dependent adhesion strengthening, independent of L-selectin binding.

Research Articles on MAdCAM1

Similar Products

Product Notes

The MAdCAM1 madcam1 (Catalog #AAA1751471) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Anti-MAdCAM1 Antibody reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MAdCAM1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 0.1-0.5 mug/ml Tested Species: In-house tested species with positive results. Researchers should empirically determine the suitability of the MAdCAM1 madcam1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "MAdCAM1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.