Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Flow Cytometry (FC/FACS) (Figure 1. Flow Cytometry analysis of A549 cells using anti-Human Bax antibody. Overlay histogram showing A549 cells stained with A00183-Dyl488 (Blue line).The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-Human Bax Antibody for 30 min at 20 degree C. DyLight® 488 conjugated goat anti-rabbit IgG (5-10ug/1x106 cells) was used as secondary antibody for 30 minutes at 20 degree C. Isotype control antibody (Green line) was rabbit IgG (1ug/1x106) used under the same conditions. Unlabelled sample (Red line) was also used as a control.)

Rabbit anti-Human Bax Polyclonal Antibody | anti-Bax antibody

Anti-Human Bax DyLight 488 conjugated Antibody

Gene Names
BAX; BCL2L4
Reactivity
Human
Applications
Flow Cytometry, Functional Assay
Purity
Immunogen Affinity Purified
Synonyms
Bax; Polyclonal Antibody; Anti-Human Bax DyLight 488 conjugated Antibody; Rabbit IgG Polyclonal Anti-Human Bax Antibody DyLight 488 Conjugated; Flow Validated; Apoptosis regulator BAX; Bcl-2-like protein 4; Bcl2-L-4; BAX; BCL2L4; BCL2-associated X protein; anti-Bax antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
No cross reactivity with other proteins.
Purity/Purification
Immunogen Affinity Purified
Form/Format
Liquid
Sequence Length
218
Applicable Applications for anti-Bax antibody
Flow Cytometry (FC/FACS)
Application Notes
FC/FACS: 1-3ug/1x106 cells
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human Bax (17-48aa EQIMKTGALLLQGFIQDRAGRMGGEAPELALD), different from the related mouse and rat sequences by five amino acids.
Preparation and Storage
Store at 2-8 degree C for one year. Protect from light. Do not freeze.

Flow Cytometry (FC/FACS)

(Figure 1. Flow Cytometry analysis of A549 cells using anti-Human Bax antibody. Overlay histogram showing A549 cells stained with A00183-Dyl488 (Blue line).The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-Human Bax Antibody for 30 min at 20 degree C. DyLight® 488 conjugated goat anti-rabbit IgG (5-10ug/1x106 cells) was used as secondary antibody for 30 minutes at 20 degree C. Isotype control antibody (Green line) was rabbit IgG (1ug/1x106) used under the same conditions. Unlabelled sample (Red line) was also used as a control.)

Flow Cytometry (FC/FACS) (Figure 1. Flow Cytometry analysis of A549 cells using anti-Human Bax antibody. Overlay histogram showing A549 cells stained with A00183-Dyl488 (Blue line).The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-Human Bax Antibody for 30 min at 20 degree C. DyLight® 488 conjugated goat anti-rabbit IgG (5-10ug/1x106 cells) was used as secondary antibody for 30 minutes at 20 degree C. Isotype control antibody (Green line) was rabbit IgG (1ug/1x106) used under the same conditions. Unlabelled sample (Red line) was also used as a control.)
Related Product Information for anti-Bax antibody
Apoptosis regulator BAX, also known as bcl-2-like protein 4, is a protein that in humans is encoded by the BAX gene. The protein encoded by this gene belongs to the BCL2 protein family. BCL2 family members form hetero- or homodimers and act as anti- or pro-apoptotic regulators that are involved in a wide variety of cellular activities. This protein forms a heterodimer with BCL2, and functions as an apoptotic activator. Additionally, this protein is reported to interact with, and increase the opening of, the mitochondrial voltage-dependent anion channel (VDAC), which leads to the loss in membrane potential and the release of cytochrome c. The expression of this gene is regulated by the tumor suppressor P53 and has been shown to be involved in P53-mediated apoptosis. Multiple alternatively spliced transcript variants, which encode different isoforms, have been reported for this gene.
References
1. Apte, S. S.; Mattei, M.-G.; Olsen, B. R.: Mapping of human BAX gene to chromosome 19q13.3-q13.4 and isolation of a novel alternatively spliced transcript, BAX-delta. Genomics 26: 592-594, 1995. 2. Guo, B.; Zhai, D.; Cabezas, E.; Welsh, K.; Nouraini, S.; Satterthwait, A. C.; Reed, J. C.: Humanin peptide suppresses apoptosis by interfering with Bax activation. Nature 423: 456-461, 2003. 3. Oltvai, Z. N.; Milliman, C. L.; Korsmeyer, S. J.: Bcl-2 heterodimers in vivo with a conserved homolog, Bax, that accelerates programmed cell death. Cell 74: 609-619, 1993. 4. Takeuchi, O.; Fisher, J.; Suh, H.; Harada, H.; Malynn, B. A.; Korsmeyer, S. J.: Essential role of BAX, BAK in B cell homeostasis and prevention of autoimmune disease. Proc. Nat. Acad. Sci. 102: 11272-11277, 2005.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
581
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
24,220 Da
NCBI Official Full Name
apoptosis regulator BAX isoform 1
NCBI Official Synonym Full Names
BCL2 associated X, apoptosis regulator
NCBI Official Symbol
BAX
NCBI Official Synonym Symbols
BCL2L4
NCBI Protein Information
apoptosis regulator BAX
UniProt Protein Name
Apoptosis regulator BAX
Protein Family
UniProt Gene Name
BAX
UniProt Synonym Gene Names
BCL2L4; Bcl2-L-4

NCBI Description

The protein encoded by this gene belongs to the BCL2 protein family. BCL2 family members form hetero- or homodimers and act as anti- or pro-apoptotic regulators that are involved in a wide variety of cellular activities. This protein forms a heterodimer with BCL2, and functions as an apoptotic activator. This protein is reported to interact with, and increase the opening of, the mitochondrial voltage-dependent anion channel (VDAC), which leads to the loss in membrane potential and the release of cytochrome c. The expression of this gene is regulated by the tumor suppressor P53 and has been shown to be involved in P53-mediated apoptosis. Multiple alternatively spliced transcript variants, which encode different isoforms, have been reported for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

Plays a role in the mitochondrial apoptotic process. Under normal conditions, BAX is largely cytosolic via constant retrotranslocation from mitochondria to the cytosol mediated by BCL2L1/Bcl-xL, which avoids accumulation of toxic BAX levels at the mitochondrial outer membrane (MOM) (PubMed:21458670). Under stress conditions, undergoes a conformation change that causes translocation to the mitochondrion membrane, leading to the release of cytochrome c that then triggers apoptosis. Promotes activation of CASP3, and thereby apoptosis.

Research Articles on Bax

Similar Products

Product Notes

The Bax bax (Catalog #AAA1751220) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Anti-Human Bax DyLight 488 conjugated Antibody reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's Bax can be used in a range of immunoassay formats including, but not limited to, Flow Cytometry (FC/FACS). FC/FACS: 1-3ug/1x106 cells. Researchers should empirically determine the suitability of the Bax bax for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Bax, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.