Western Blot (WB)
(Figure 1. Western blot analysis of SLC26A4 using anti-SLC26A4 antibody (MBS1750515).
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.
Lane 1: human HK-2 whole cell lysates,Lane 2: human 293T whole cell lysates.
After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-SLC26A4 antigen affinity purified polyclonal antibody at 0.5ug/mL overnight at 4 degree C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for SLC26A4 at approximately 86KD. The expected band size for SLC26A4 is at 86KD. )
Rabbit SLC26A4 Polyclonal Antibody | anti-SLC26A4 antibody
Anti-SLC26A4 Picoband antibody
Gene Names
SLC26A4; EVA; PDS; DFNB4; TDH2B
Reactivity
Human, Mouse, RatNo cross reactivity with other proteins.
Applications
Western Blot
Synonyms
SLC26A4; Polyclonal Antibody; Anti-SLC26A4 Picoband antibody; Pendrin; Sodium-independent chloride/iodide transporter; Solute carrier family 26 member 4; PDS; anti-SLC26A4 antibody
Host
Rabbit
Reactivity
Human, Mouse, Rat
No cross reactivity with other proteins.
No cross reactivity with other proteins.
Clonality
Polyclonal
Form/Format
Lyophilized
Sequence Length
349
Applicable Applications for anti-SLC26A4 antibody
Western Blot (WB)
Application Notes
WB: 0.1-0.5mug/ml
Immunogen
A synthetic peptide corresponding to a sequence of human SLC26A4 (RSLRVIVKEFQRIDVNVYFASLQDYVIEKLEQ).
Subcellular Localization
Membrane; Localizes to the apical brush border of cells in the cortical collecting ducts of the kidney.
Tissue Specificity
High expression in adult thyroid, lower expression in adult and fetal kidney and fetal brain. Not expressed in other tissues.
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Contents
Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Preparation and Storage
Store at -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.
Western Blot (WB)
(Figure 1. Western blot analysis of SLC26A4 using anti-SLC26A4 antibody (MBS1750515). Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions. Lane 1: human HK-2 whole cell lysates,Lane 2: human 293T whole cell lysates. After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-SLC26A4 antigen affinity purified polyclonal antibody at 0.5ug/mL overnight at 4 degree C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for SLC26A4 at approximately 86KD. The expected band size for SLC26A4 is at 86KD. )
Western Blot (WB)
(Figure 1. Western blot analysis of SLC26A4 using anti-SLC26A4 antibody (MBS1750515).
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.
Lane 1: human HK-2 whole cell lysates,Lane 2: human 293T whole cell lysates.
After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-SLC26A4 antigen affinity purified polyclonal antibody at 0.5ug/mL overnight at 4 degree C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for SLC26A4 at approximately 86KD. The expected band size for SLC26A4 is at 86KD. )
Related Product Information for anti-SLC26A4 antibody
Description: Pendrin, is an anion exchange protein that in humans is encoded by the SLC26A4 gene. Pendrin is an ion exchanger found in many types of cells in the body. High levels of pendrin expression have been identified in the inner ear and thyroid. In the thyroid, pendrin mediates a component of the efflux of iodide across the apical membrane of the thyrocyte, which is critical for the formation of thyroid hormone. The exact function of pendrin in the inner ear remains unclear; however, pendrin may play a role in acid-base balance as a chloride-bicarbonate exchanger, regulate volume homeostasis through its ability to function as a chloride-formate exchanger or indirectly modulate the calcium concentration of the endolymph.
Protein Function: Sodium-independent transporter of chloride and iodide.
Protein Function: Sodium-independent transporter of chloride and iodide.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
39,267 Da
NCBI Official Full Name
pendrin
NCBI Official Synonym Full Names
solute carrier family 26 member 4
NCBI Official Symbol
SLC26A4
NCBI Official Synonym Symbols
EVA; PDS; DFNB4; TDH2B
NCBI Protein Information
pendrin
UniProt Protein Name
Pendrin
Protein Family
UniProt Gene Name
SLC26A4
UniProt Synonym Gene Names
PDS
NCBI Description
Mutations in this gene are associated with Pendred syndrome, the most common form of syndromic deafness, an autosomal-recessive disease. It is highly homologous to the SLC26A3 gene; they have similar genomic structures and this gene is located 3' of the SLC26A3 gene. The encoded protein has homology to sulfate transporters. [provided by RefSeq, Jul 2008]
Uniprot Description
Sodium-independent transporter of chloride and iodide.
Research Articles on SLC26A4
Similar Products
Product Notes
The SLC26A4 slc26a4 (Catalog #AAA1750515) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Anti-SLC26A4 Picoband antibody reacts with Human, Mouse, Rat No cross reactivity with other proteins. and may cross-react with other species as described in the data sheet. AAA Biotech's SLC26A4 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 0.1-0.5mug/ml. Researchers should empirically determine the suitability of the SLC26A4 slc26a4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SLC26A4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
