Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Figure 1. Western blot analysis of SMAD1 using anti-SMAD1 antibody (MBS1750468). Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions. Lane 1: rat kidney tissue lysate,Lane 2: rat testis tissue lysate,Lane 3: mouse brain tissue lysate,Lane 4: mouse kidney tissue lysate,Lane 5: mouse testis tissue lysate,Lane 6: human Hela cell lysate,Lane 7: human A375 cell lysate,Lane 8: human HepG2 cell lysate. After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-SMAD1 antigen affinity purified polyclonal antibody at 0.5ug/mL overnight at 4 degree C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for SMAD1 at approximately 52,60KD. The expected band size for SMAD1 is at 48, 52, 60KD. )

Rabbit SMAD1/SMAD5 Polyclonal Antibody | anti-SMAD1/SMAD5 antibody

Anti-SMAD1/SMAD5 Picoband antibody

Gene Names
SMAD1; BSP1; JV41; BSP-1; JV4-1; MADH1; MADR1
Reactivity
Human, Mouse, Rat
No cross reactivity with other proteins.
Applications
Western Blot
Synonyms
SMAD1/SMAD5; Polyclonal Antibody; Anti-SMAD1/SMAD5 Picoband antibody; Mothers against decapentaplegic homolog 1; MAD homolog 1; Mothers against DPP homolog 1; JV4-1; Mad-related protein 1; SMAD family member 1; SMAD 1; Smad1; hSMAD1; Transforming growth factor-beta-signaling protein 1; BSP-1; SMAD1; BSP1; MADH1; MADR1; Mothers against decapentaplegic homolog 5; MAD homolog 5; Mothers against DPP homolog 5; JV5-1; SMAD family member 5; SMAD 5; Smad5; hSmad5; SMAD5; MADH5; anti-SMAD1/SMAD5 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse, Rat
No cross reactivity with other proteins.
Clonality
Polyclonal
Form/Format
Lyophilized
Sequence Length
137
Applicable Applications for anti-SMAD1/SMAD5 antibody
Western Blot (WB)
Application Notes
WB: 0.1-0.5mug/ml
Immunogen
A synthetic peptide corresponding to a sequence of human SMAD1/SMAD5 (KRLLGWKQGDEEEKWAEKAVDALVKKLKKKKGAMEELEK).
Subcellular Localization
Cytoplasm.
Tissue Specificity
Ubiquitous. Highest expression seen in the heart and skeletal muscle.
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Contents
Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Preparation and Storage
Store at -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

Western Blot (WB)

(Figure 1. Western blot analysis of SMAD1 using anti-SMAD1 antibody (MBS1750468). Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions. Lane 1: rat kidney tissue lysate,Lane 2: rat testis tissue lysate,Lane 3: mouse brain tissue lysate,Lane 4: mouse kidney tissue lysate,Lane 5: mouse testis tissue lysate,Lane 6: human Hela cell lysate,Lane 7: human A375 cell lysate,Lane 8: human HepG2 cell lysate. After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-SMAD1 antigen affinity purified polyclonal antibody at 0.5ug/mL overnight at 4 degree C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for SMAD1 at approximately 52,60KD. The expected band size for SMAD1 is at 48, 52, 60KD. )

Western Blot (WB) (Figure 1. Western blot analysis of SMAD1 using anti-SMAD1 antibody (MBS1750468). Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions. Lane 1: rat kidney tissue lysate,Lane 2: rat testis tissue lysate,Lane 3: mouse brain tissue lysate,Lane 4: mouse kidney tissue lysate,Lane 5: mouse testis tissue lysate,Lane 6: human Hela cell lysate,Lane 7: human A375 cell lysate,Lane 8: human HepG2 cell lysate. After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-SMAD1 antigen affinity purified polyclonal antibody at 0.5ug/mL overnight at 4 degree C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for SMAD1 at approximately 52,60KD. The expected band size for SMAD1 is at 48, 52, 60KD. )
Related Product Information for anti-SMAD1/SMAD5 antibody
Transcriptional modulator activated by BMP (bone morphogenetic proteins) type 1 receptor kinase. SMAD1 is a receptor-regulated SMAD (R-SMAD). SMAD1/OAZ1/PSMB4 complex mediates the degradation of the CREBBP/EP300 repressor SNIP1. May act synergistically with SMAD4 and YY1 in bone morphogenetic protein (BMP)-mediated cardiac-specific gene expression.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
15,406 Da
NCBI Official Full Name
mothers against decapentaplegic homolog 1
NCBI Official Synonym Full Names
SMAD family member 1
NCBI Official Symbol
SMAD1
NCBI Official Synonym Symbols
BSP1; JV41; BSP-1; JV4-1; MADH1; MADR1
NCBI Protein Information
mothers against decapentaplegic homolog 1
UniProt Protein Name
Mothers against decapentaplegic homolog 1
UniProt Gene Name
SMAD1
UniProt Synonym Gene Names
BSP1; MADH1; MADR1; MAD homolog 1; Mothers against DPP homolog 1; SMAD 1; Smad1; hSMAD1; BSP-1

NCBI Description

The protein encoded by this gene belongs to the SMAD, a family of proteins similar to the gene products of the Drosophila gene 'mothers against decapentaplegic' (Mad) and the C. elegans gene Sma. SMAD proteins are signal transducers and transcriptional modulators that mediate multiple signaling pathways. This protein mediates the signals of the bone morphogenetic proteins (BMPs), which are involved in a range of biological activities including cell growth, apoptosis, morphogenesis, development and immune responses. In response to BMP ligands, this protein can be phosphorylated and activated by the BMP receptor kinase. The phosphorylated form of this protein forms a complex with SMAD4, which is important for its function in the transcription regulation. This protein is a target for SMAD-specific E3 ubiquitin ligases, such as SMURF1 and SMURF2, and undergoes ubiquitination and proteasome-mediated degradation. Alternatively spliced transcript variants encoding the same protein have been observed. [provided by RefSeq, Jul 2008]

Uniprot Description

Transcriptional modulator activated by BMP (bone morphogenetic proteins) type 1 receptor kinase. SMAD1 is a receptor-regulated SMAD (R-SMAD). SMAD1/OAZ1/PSMB4 complex mediates the degradation of the CREBBP/EP300 repressor SNIP1. May act synergistically with SMAD4 and YY1 in bone morphogenetic protein (BMP)-mediated cardiac-specific gene expression.

Research Articles on SMAD1/SMAD5

Similar Products

Product Notes

The SMAD1/SMAD5 smad1 (Catalog #AAA1750468) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Anti-SMAD1/SMAD5 Picoband antibody reacts with Human, Mouse, Rat No cross reactivity with other proteins. and may cross-react with other species as described in the data sheet. AAA Biotech's SMAD1/SMAD5 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 0.1-0.5mug/ml. Researchers should empirically determine the suitability of the SMAD1/SMAD5 smad1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SMAD1/SMAD5, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.