Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

WD repeat-containing protein tag-125 (tag-125) Recombinant Protein | tag-125 recombinant protein

Recombinant Caenorhabditis elegans WD repeat-containing protein tag-125 (tag-125)

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
WD repeat-containing protein tag-125 (tag-125); Recombinant Caenorhabditis elegans WD repeat-containing protein tag-125 (tag-125); tag-125 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-376, Full length
Sequence
MDTSENAASAAEQQPTQQIDQLTVPNAPDGGSSAPAPSTSPNSISPSNPTGTPAPGASAQTPNPNAAGASASGSANYKLMCTLEGHTKSISSAKFSPCGKYLGTSSADKTVKIWNMDHMICERTLTGHKLGVNDIAWSSDSRCVVSASDDKTLKIFEIVTSRMTKTLKGHNNYVFCCNFNPQSSLVVSGSFDESVRIWDVKTGMCIKTLPAHSDPVSAVSFNRDGSLIASGSYDGLVRIWDTANGQCIKTLVDDENPPVAFVKFSPNGKYILASNLDSTLKLWDFSKGKTLKQYTGHENSKYCIFANFSVTGGKWIISGSEDCKIYIWNLQTREIVQCLEGHTQPVLASDCHPVQNIIASGALEPDNKIHIWRSDV
Sequence Length
376
Species
Caenorhabditis elegans
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
40,393 Da
NCBI Official Full Name
WD repeat-containing protein wdr-5.1
NCBI Official Symbol
wdr-5.1
NCBI Protein Information
WD repeat-containing protein wdr-5.1
UniProt Protein Name
WD repeat-containing protein wdr-5.1
UniProt Gene Name
wdr-5.1
UniProt Synonym Gene Names
swd-3.1; tag-125

Uniprot Description

Contributes to histone modification (PubMed:16710447, PubMed:17967446, PubMed:20188723, PubMed:20555324, PubMed:21455483, PubMed:22012258). May position the N-terminus of histone H3 for efficient trimethylation at 'Lys-4' (PubMed:21455483). Required for di- and trimethylation, particularly for the trimethylation at 'Lys-4' of histone H3 (PubMed:20555324, PubMed:21455483, PubMed:24682813, PubMed:21527717). Not required for demethylation of histone H3 'Lys-27' (PubMed:21455483). H3 'Lys-4' methylation represents a specific tag for epigenetic transcriptional activation, germline establishment, maintenance and function (PubMed:21455483). Implicated in the epigenetic inheritance of lifespan over several generations (PubMed:22012258). Acts in the germline to limit the longevity of the soma, probably by regulating a lipid metabolism pathway that signals from the germline to the intestine, thereby preventing accumulation of mono-unsaturated fatty acids (PubMed:17967446, PubMed:20555324, PubMed:28379943). Required for RNA interference with probable antagonistic role against hpl-2 function (PubMed:17967446). Plays a role in vulval cell fate specification by acting in the synthetic multivulva pathway independent of set-2 (PubMed:17967446). Sex determining protein required in the germline to promote the spermatogenesis to oogenesis switch during the late larval stages of development (PubMed:24682813). Acts with the sex determining factor tra-1, and redundantly with wdr-5.2, to regulate fog-3 expression, which in turn determines germ cell fate (PubMed:24682813). Cooperates with jmjd-3.1, egl-27 and unc-3 to ensure robust transdifferentiation of the Y rectal cell to the PDA motor neuron during larval development (PubMed:25124442).

Research Articles on tag-125

Similar Products

Product Notes

The tag-125 wdr-5.1 (Catalog #AAA1487983) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-376, Full length. The amino acid sequence is listed below: MDTSENAASA AEQQPTQQID QLTVPNAPDG GSSAPAPSTS PNSISPSNPT GTPAPGASAQ TPNPNAAGAS ASGSANYKLM CTLEGHTKSI SSAKFSPCGK YLGTSSADKT VKIWNMDHMI CERTLTGHKL GVNDIAWSSD SRCVVSASDD KTLKIFEIVT SRMTKTLKGH NNYVFCCNFN PQSSLVVSGS FDESVRIWDV KTGMCIKTLP AHSDPVSAVS FNRDGSLIAS GSYDGLVRIW DTANGQCIKT LVDDENPPVA FVKFSPNGKY ILASNLDSTL KLWDFSKGKT LKQYTGHENS KYCIFANFSV TGGKWIISGS EDCKIYIWNL QTREIVQCLE GHTQPVLASD CHPVQNIIAS GALEPDNKIH IWRSDV. It is sometimes possible for the material contained within the vial of "WD repeat-containing protein tag-125 (tag-125), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.