Interleukin-22 receptor subunit alpha-2 (IL22RA2) Recombinant Protein | IL22RA2 recombinant protein
Recombinant Human Interleukin-22 receptor subunit alpha-2 (IL22RA2)
Gene Names
IL22RA2; CRF2X; CRF2-10; CRF2-S1; IL-22BP; IL-22RA2; ZCYTOR16; IL-22R-alpha-2
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Interleukin-22 receptor subunit alpha-2 (IL22RA2); Recombinant Human Interleukin-22 receptor subunit alpha-2 (IL22RA2); IL22RA2 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
22-263, Full length protein
Sequence
TQSTHESLKPQRVQFQSRNFHNILQWQPGRALTGNSSVYFVQYKIMFSCSMKSSHQKPSGCWQHISCNFPGCRTLAKYGQRQWKNKEDCWGTQELSCDLTSETSDIQEPYYGRVRAASAGSYSEWSMTPRFTPWWETKIDPPVMNITQVNGSLLVILHAPNLPYRYQKEKNVSIEDYYELLYRVFIINNSLEKEQKVYEGAHRAVEIEALTPHSSYCVVAEIYQPMLDRRSQRSEERCVEIP
Sequence Length
242
Species
Human
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for IL22RA2 recombinant protein
This protein is a soluble class II cytokine receptor. This protein has been shown to specifically bind to interleukin 22 (IL22), block the interaction of IL22 with its cell surface receptor, and thus inhibit IL22 activity. This protein functions as an IL22 antagonist, and may be important in the regulation of inflammatory response. Three alternatively spliced transcript variants encoding distinct isoforms have been described.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
15,128 Da
NCBI Official Full Name
interleukin-22 receptor subunit alpha-2 isoform 1
NCBI Official Synonym Full Names
interleukin 22 receptor subunit alpha 2
NCBI Official Symbol
IL22RA2
NCBI Official Synonym Symbols
CRF2X; CRF2-10; CRF2-S1; IL-22BP; IL-22RA2; ZCYTOR16; IL-22R-alpha-2
NCBI Protein Information
interleukin-22 receptor subunit alpha-2
UniProt Protein Name
Interleukin-22 receptor subunit alpha-2
Protein Family
UniProt Gene Name
IL22RA2
UniProt Synonym Gene Names
IL-22 receptor subunit alpha-2; IL-22R-alpha-2; IL-22RA2; CRF2-10; CRF2-S1; IL-22BP; IL22BP
NCBI Description
This gene encodes a member of the class II cytokine receptor family. The encoded soluble protein specifically binds to and inhibits interleukin 22 activity by blocking the interaction of interleukin 22 with its cell surface receptor. The encoded protein may be important in the regulation of inflammatory response, and has been implicated in the regulation of tumorigenesis in the colon. Alternative splicing results in multiple transcript variants encoding distinct isoforms. [provided by RefSeq, Jul 2013]
Uniprot Description
Isoform 2 is a receptor for IL22. Binds to IL22, prevents interaction with the functional IL-22R complex and blocks the activity of IL22 (in vitro). May play an important role as an IL22 antagonist in the regulation of inflammatory responses.
Research Articles on IL22RA2
Similar Products
Product Notes
The IL22RA2 il22ra2 (Catalog #AAA1484910) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 22-263, Full length protein. The amino acid sequence is listed below: TQSTHESLKP QRVQFQSRNF HNILQWQPGR ALTGNSSVYF VQYKIMFSCS MKSSHQKPSG CWQHISCNFP GCRTLAKYGQ RQWKNKEDCW GTQELSCDLT SETSDIQEPY YGRVRAASAG SYSEWSMTPR FTPWWETKID PPVMNITQVN GSLLVILHAP NLPYRYQKEK NVSIEDYYEL LYRVFIINNS LEKEQKVYEG AHRAVEIEAL TPHSSYCVVA EIYQPMLDRR SQRSEERCVE IP. It is sometimes possible for the material contained within the vial of "Interleukin-22 receptor subunit alpha-2 (IL22RA2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
