Peptidyl-prolyl cis-trans isomerase D (Ppid) Recombinant Protein | Ppid recombinant protein
Recombinant Rat Peptidyl-prolyl cis-trans isomerase D (Ppid)
Gene Names
Ppid; CypD; Cyp-40
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Peptidyl-prolyl cis-trans isomerase D (Ppid); Recombinant Rat Peptidyl-prolyl cis-trans isomerase D (Ppid); Ppid recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
2-370, full length protein
Sequence
SHPSPAGKPSNSKNPRVFFDVDIGGERVGRIVLELFADIVPKTAENFRALCTGEKGTGPTTGKPLHFKGCPFHRIIKKFMIQGGDFSNQNGTGGESIYGEKFEDENFHYKHDREGLLSMANAGPNTNGSQFFITTVPTPHLDGKHVVFGQVIKGLGVARMLENVEVNGEKPAKLCVIAECGELKEGDEWGIFPKDGSGDSHPDFPEDADIDLKDVDKILLISEDLKNIGNTFFKSQNWEMAIKKYAKVLRYLDSSKAVIEKADVSRLQPIALSCVLNIGACKLKMSNWQGAIDSCLEALEMDPSNTKALYRKAQGWQGLKEYDQALADLKKAQEIAPGDKAIQAELLKVKQMIKAQKDKEKAVYAKMFA
Sequence Length
369
Species
Rat
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Ppid recombinant protein
This protein is a member of the peptidyl-prolyl cis-trans isomerase (PPIase) family. PPIases catalyze the cis-trans isomerization of proline imidic peptide bonds in oligopeptides and accelerate the folding of proteins. This protein has been shown to possess PPIase activity and, similar to other family members, can bind to the immunosuppressant cyclosporin A.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
40,766 Da
NCBI Official Full Name
peptidyl-prolyl cis-trans isomerase D
NCBI Official Synonym Full Names
peptidylprolyl isomerase D
NCBI Official Symbol
Ppid
NCBI Official Synonym Symbols
CypD; Cyp-40
NCBI Protein Information
peptidyl-prolyl cis-trans isomerase D
UniProt Protein Name
Peptidyl-prolyl cis-trans isomerase D
Protein Family
UniProt Gene Name
Ppid
UniProt Synonym Gene Names
PPIase D; CYP-40
Uniprot Description
PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides. Proposed to act as a co-chaperone in HSP90 complexes such as in unligated steroid receptors heterocomplexes. Different co-chaperones seem to compete for association with HSP90 thus establishing distinct HSP90-co-chaperone-receptor complexes with the potential to exert tissue-specific receptor activity control. May have a preference for estrogen receptor complexes and is not found in glucocorticoid receptor complexes. May be involved in cytoplasmic dynein-dependent movement of the receptor from the cytoplasm to the nucleus. May regulate MYB by inhibiting its DNA-binding activity. Involved in regulation of AHR signaling by promoting the formation of the AHR:ARNT dimer; the function is independent of HSP90 but requires the chaperone activity region. Involved in regulation of UV radiation-induced apoptosis.
Research Articles on Ppid
Similar Products
Product Notes
The Ppid ppid (Catalog #AAA1483707) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 2-370, full length protein. The amino acid sequence is listed below: SHPSPAGKPS NSKNPRVFFD VDIGGERVGR IVLELFADIV PKTAENFRAL CTGEKGTGPT TGKPLHFKGC PFHRIIKKFM IQGGDFSNQN GTGGESIYGE KFEDENFHYK HDREGLLSMA NAGPNTNGSQ FFITTVPTPH LDGKHVVFGQ VIKGLGVARM LENVEVNGEK PAKLCVIAEC GELKEGDEWG IFPKDGSGDS HPDFPEDADI DLKDVDKILL ISEDLKNIGN TFFKSQNWEM AIKKYAKVLR YLDSSKAVIE KADVSRLQPI ALSCVLNIGA CKLKMSNWQG AIDSCLEALE MDPSNTKALY RKAQGWQGLK EYDQALADLK KAQEIAPGDK AIQAELLKVK QMIKAQKDKE KAVYAKMFA. It is sometimes possible for the material contained within the vial of "Peptidyl-prolyl cis-trans isomerase D (Ppid), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
