Phosphorylated adapter RNA export protein (Phax) Recombinant Protein | Phax recombinant protein

Recombinant Rat Phosphorylated adapter RNA export protein (Phax)

Cat. Num. AAA1482069

• Gene Names: Phax; Rnuxa
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Phosphorylated adapter RNA export protein (Phax); Recombinant Rat Phosphorylated adapter RNA export protein (Phax); Phax recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 2-385, full length protein
• Sequence: ALEAGDMEEGQLSDSDSDMTVVPSDRPLQMAKVLGGGGAACAPVSNYRTVKHVDSSEESLDSDDDCSLWKRKRQKCHSPPPKPEPFPFGQSGQKPALNGGKKVNNIWGAVLQEQNQDAVATELGILGMEGTIDRSRQSETYNYLLAKKLAKKESQEYTKELDKDLDEYMHGDKKPGSKEEENGQGHLKRKRPVRDRLGNRVEMNYKGRYDITEEDSPEKVADEIAFRLQEPKKDLIARVVTILGNKKAIELLMETAEVEQNGGLFIMNGSRRRTPGGVFLNLLKNTPSISEEQIKDIFYIENQKEYENKKAARKRRTQLLGKKMKEAIKSLNFQEDDDTSRETFASDTNEALASLDEAQEGPGETKLDAEDAIEVDHPQDLDIF
• Sequence Length: 384

• Species: Rat
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

• NCBI GI #: 158533982
• NCBI GeneID: 286917
• NCBI Accession #: NP_775156.2
• NCBI GenBank Nucleotide #: NM_173133.2
• UniProt Accession #: Q63068; Q4QQW9; Q5RJZ7
• Molecular Weight: 43,166 Da
• NCBI Official Full Name: phosphorylated adapter RNA export protein
• NCBI Official Synonym Full Names: phosphorylated adaptor for RNA export
• NCBI Official Symbol: Phax
• NCBI Official Synonym Symbols: Rnuxa
• NCBI Protein Information: phosphorylated adapter RNA export protein
• UniProt Protein Name: Phosphorylated adapter RNA export protein
• Protein Family: Phosphorylated adapter RNA export protein
• UniProt Gene Name: Phax
• UniProt Synonym Gene Names: Rnuxa; RBP-2

NCBI Description

resiniferatoxin-binding protein; may have a role in neuronal function [RGD, Feb 2006]

Uniprot Description

A phosphoprotein adapter involved in the XPO1-mediated U snRNA export from the nucleus. Bridge components required for U snRNA export, the cap binding complex (CBC)-bound snRNA on the one hand and the GTPase Ran in its active GTP-bound form together with the export receptor XPO1 on the other. Its phosphorylation in the nucleus is required for U snRNA export complex assembly and export, while its dephosphorylation in the cytoplasm causes export complex disassembly. It is recycled back to the nucleus via the importin alpha/beta heterodimeric import receptor. The directionality of nuclear export is thought to be conferred by an asymmetric distribution of the GTP- and GDP-bound forms of Ran between the cytoplasm and nucleus. Its compartmentalized phosphorylation cycle may also contribute to the directionality of export. Binds strongly to m7G-capped U1 and U5 small nuclear RNAs (snRNAs) in a sequence-unspecific manner and phosphorylation-independent manner. Plays also a role in the biogenesis of U3 small nucleolar RNA (snoRNA). Involved in the U3 snoRNA transport from nucleoplasm to Cajal bodies. Binds strongly to m7G-capped U3, U8 and U13 precursor snoRNAs and weakly to trimethylated (TMG)-capped U3, U8 and U13 snoRNAs. Binds also to telomerase RNA ().