Set1/Ash2 histone methyltransferase complex subunit ASH2 (Ash2l) Recombinant Protein | Ash2l recombinant protein
Recombinant Mouse Set1/Ash2 histone methyltransferase complex subunit ASH2 (Ash2l)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Set1/Ash2 histone methyltransferase complex subunit ASH2 (Ash2l); Recombinant Mouse Set1/Ash2 histone methyltransferase complex subunit ASH2 (Ash2l); Ash2l recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-623, Full length protein
Sequence
MAAAGAGPGPGVSAGPGPGAAASATTAEDRETEPVAAGAGEGPSAAPGAEPSSGEAESGDANLVDVSGLETESSNGKDTLEGTGDTSEVMDTQAGSVDEENGRQLGEVELQCGICTKWFTADTFGIDTSSCLPFMTNYSFHCNVCHHSGNTYFLRKQANLKEMCLSALANLTWQSRTQDEHPKTMFSKDKDIIPFIDKYWECMTTRQRPGKMTWPNNIVKTMSKERDVFLVKEHPDPGSKDPEEDYPKFGLLDQDLSNIGPAYDNQKQSSAVSASGNLNGGIAAGSSGKGRGAKRKQQDGGTTGTTKKARSDPLFSAQRLPPHGYPLEHPFNKDGYRYILAEPDPHAPDPEKLELDCWAGKPIPGDLYRACLYERVLLALHDRAPQLKISDDRLTVVGEKGYSMVRASHGVRKGAWYFEITVDEMPPDTAARLGWSQPLGNLQAPLGYDKFSYSWRSKKGTKFHQSIGKHYSSGYGQGDVLGFYINLPEDTETAKSLPDTYKDKALIKFKSYLYFEEKDFVDKAEKSLKQTPHSEIIFYKNGVNQGVAYRDIFEGVYFPAISLYKSCTVSINFGPSFKYPPKDLTYHPMSDMGWGAVVEHTLADVLYHVETEVDGRRSPPWEP
Sequence Length
623
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
68,250 Da
NCBI Official Full Name
set1/Ash2 histone methyltransferase complex subunit ASH2 isoform a
NCBI Official Synonym Full Names
ASH2 like histone lysine methyltransferase complex subunit
NCBI Official Symbol
Ash2l
NCBI Protein Information
set1/Ash2 histone methyltransferase complex subunit ASH2
UniProt Protein Name
Set1/Ash2 histone methyltransferase complex subunit ASH2
UniProt Gene Name
Ash2l
Uniprot Description
Component of the Set1/Ash2 histone methyltransferase (HMT) complex, a complex that specifically methylates 'Lys-4' of histone H3, but not if the neighboring 'Lys-9' residue is already methylated. As part of the MLL1/MLL complex it is involved in methylation and dimethylation at 'Lys-4' of histone H3. May function as a transcriptional regulator. May play a role in hematopoiesis ().
Research Articles on Ash2l
Similar Products
Product Notes
The Ash2l ash2l (Catalog #AAA1481658) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-623, Full length protein. The amino acid sequence is listed below: MAAAGAGPGP GVSAGPGPGA AASATTAEDR ETEPVAAGAG EGPSAAPGAE PSSGEAESGD ANLVDVSGLE TESSNGKDTL EGTGDTSEVM DTQAGSVDEE NGRQLGEVEL QCGICTKWFT ADTFGIDTSS CLPFMTNYSF HCNVCHHSGN TYFLRKQANL KEMCLSALAN LTWQSRTQDE HPKTMFSKDK DIIPFIDKYW ECMTTRQRPG KMTWPNNIVK TMSKERDVFL VKEHPDPGSK DPEEDYPKFG LLDQDLSNIG PAYDNQKQSS AVSASGNLNG GIAAGSSGKG RGAKRKQQDG GTTGTTKKAR SDPLFSAQRL PPHGYPLEHP FNKDGYRYIL AEPDPHAPDP EKLELDCWAG KPIPGDLYRA CLYERVLLAL HDRAPQLKIS DDRLTVVGEK GYSMVRASHG VRKGAWYFEI TVDEMPPDTA ARLGWSQPLG NLQAPLGYDK FSYSWRSKKG TKFHQSIGKH YSSGYGQGDV LGFYINLPED TETAKSLPDT YKDKALIKFK SYLYFEEKDF VDKAEKSLKQ TPHSEIIFYK NGVNQGVAYR DIFEGVYFPA ISLYKSCTVS INFGPSFKYP PKDLTYHPMS DMGWGAVVEH TLADVLYHVE TEVDGRRSPP WEP. It is sometimes possible for the material contained within the vial of "Set1/Ash2 histone methyltransferase complex subunit ASH2 (Ash2l), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
