Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

WAP four-disulfide core domain protein 12 (WFDC12) Recombinant Protein | WFDC12 recombinant protein

Recombinant Human WAP four-disulfide core domain protein 12 (WFDC12)

Gene Names
WFDC12; WAP2; SWAM2; C20orf122; dJ211D12.4
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
WAP four-disulfide core domain protein 12 (WFDC12); Recombinant Human WAP four-disulfide core domain protein 12 (WFDC12); WFDC12 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
24-111, Full length protein
Sequence
VKEGIEKAGVCPADNVRCFKSDPPQCHTDQDCLGERKCCYLHCGFKCVIPVKELEEGGNKDEDVSRPYPEPGWEAKCPGSSSTRCPQK
Sequence Length
88
Species
Human
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for WFDC12 recombinant protein
This gene encodes a member of the WAP-type four-disulfide core (WFDC) domain family. The WFDC domain, or WAP signature motif, contains eight cysteines forming four disulfide bonds at the core of the protein, and functions as a protease inhibitor. Most WFDC gene members are localized to chromosome 20q12-q13 in two clusters: centromeric and telomeric. This gene belongs to the centromeric cluster.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
12,050 Da
NCBI Official Full Name
WAP four-disulfide core domain protein 12
NCBI Official Synonym Full Names
WAP four-disulfide core domain 12
NCBI Official Symbol
WFDC12
NCBI Official Synonym Symbols
WAP2; SWAM2; C20orf122; dJ211D12.4
NCBI Protein Information
WAP four-disulfide core domain protein 12
UniProt Protein Name
WAP four-disulfide core domain protein 12
UniProt Gene Name
WFDC12
UniProt Synonym Gene Names
C20orf122; WAP2

NCBI Description

This gene encodes a member of the WAP-type four-disulfide core (WFDC) domain family. The WFDC domain, or WAP signature motif, contains eight cysteines forming four disulfide bonds at the core of the protein, and functions as a protease inhibitor. Most WFDC gene members are localized to chromosome 20q12-q13 in two clusters: centromeric and telomeric. This gene belongs to the centromeric cluster. [provided by RefSeq, Jul 2008]

Uniprot Description

Antibacterial protein. Putative acid-stable proteinase inhibitor.

Research Articles on WFDC12

Similar Products

Product Notes

The WFDC12 wfdc12 (Catalog #AAA1481024) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 24-111, Full length protein. The amino acid sequence is listed below: VKEGIEKAGV CPADNVRCFK SDPPQCHTDQ DCLGERKCCY LHCGFKCVIP VKELEEGGNK DEDVSRPYPE PGWEAKCPGS SSTRCPQK. It is sometimes possible for the material contained within the vial of "WAP four-disulfide core domain protein 12 (WFDC12), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.