Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Poly (A)-specific ribonuclease PARN (parn) Recombinant Protein | parn recombinant protein

Recombinant Xenopus laevis Poly (A)-specific ribonuclease PARN (parn), partial

Gene Names
parn.L; parn; xparn; parn-A
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Poly (A)-specific ribonuclease PARN (parn); Recombinant Xenopus laevis Poly (A)-specific ribonuclease PARN (parn); partial; parn recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
178-244, Provide the R3H Domain
Sequence
KGFIDKVVERVEDFLKNEQKSMNVEPCTGYQRKLIYQTLNWKYPRGIHVETVESEKKERYIVISKVD
Sequence Length
244
Species
Xenopus laevis (African clawed frog)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
72,846 Da
NCBI Official Full Name
poly(A)-specific ribonuclease PARN
NCBI Official Synonym Full Names
poly(A)-specific ribonuclease L homeolog
NCBI Official Symbol
parn.L
NCBI Official Synonym Symbols
parn; xparn; parn-A
NCBI Protein Information
poly(A)-specific ribonuclease PARN
UniProt Protein Name
Poly(A)-specific ribonuclease PARN
UniProt Gene Name
parn

Uniprot Description

3'-exoribonuclease that has a preference for poly(A) tails of mRNAs, thereby efficiently degrading poly(A) tails. Exonucleolytic degradation of the poly(A) tail is often the first step in the decay of eukaryotic mRNAs. Required during meiotic maturation to silence certain maternal mRNAs translationally. Does not require an adenosine residue at the 3' end, however, the addition of 25 non-adenylate residues at the 3' terminus, or a 3' terminal phosphate is inhibitory. Involved in dormant mRNAs regulation during oocyte maturation by counteracting polyadenylation mediated by papd4/gld2nt in immature eggs. During maturation it is excluded from the ribonucleoprotein complex, allowing poly(A) elongation by papd4/gld2nt and activation of mRNAs.

Similar Products

Product Notes

The parn parn (Catalog #AAA1470360) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 178-244, Provide the R3H Domain. The amino acid sequence is listed below: KGFIDKVVER VEDFLKNEQK SMNVEPCTGY QRKLIYQTLN WKYPRGIHVE TVESEKKERY IVISKVD . It is sometimes possible for the material contained within the vial of "Poly (A)-specific ribonuclease PARN (parn), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.