Short/branched chain specific acyl-CoA dehydrogenase, mitochondrial (Acadsb) Recombinant Protein | Acadsb recombinant protein
Recombinant Mouse Short/branched chain specific acyl-CoA dehydrogenase, mitochondrial (Acadsb)
Gene Names
Acadsb; SBCAD; 2-MEBCAD; BB066609; 1300003O09Rik
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Short/branched chain specific acyl-CoA dehydrogenase; mitochondrial (Acadsb); Recombinant Mouse Short/branched chain specific acyl-CoA dehydrogenase; Acadsb recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
34-432, full length protein
Sequence
KSSQPEALVSLTNNAVAFAPLQTLTDEEIMMKQTVKKFAQEHVAPLVSSMDENSKMEKSVIQGLFQQGLMGIEVEAQYGGTEASFFCSVLVIEELAKVDASVALLCDIQNTIINNLFRKHASEEQKATYLPKLVTEKLGSFCLSEAGAGSDSFAMKTRADKSGNYYVLNGSKMWISHAEHAELFLVFANVDPSSGYRGITCFLVDRDTEGFQIGKRENKMGIRASSTCQLTFENVKVPETNILGKIGHGYKYAIGSLNEGRIGIAAQMLGLAQGCFDYTIPYIKERMQFGKRIFDFQGLQHQVAQVATQLEATRLLTYNAARLVEAGRPFIKEASMAKYYASEVAGLTTSKCIEWMGGVGYTKDYPVEKFFRDAKIGTIYEGASNIQLNTIAKHIDAEY
Sequence Length
399
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Acadsb recombinant protein
Short
branched chain acyl-CoA dehydrogenase(ACADSB) is a member of the acyl-CoA dehydrogenase family of enzymes that catalyze the dehydrogenation of acyl-CoA derivatives in the metabolism of fatty acids or branch chained amino acids. Substrate specificity is the primary characteristic used to define members of this gene family. The ACADSB gene product has the greatest activity towards the short branched chain acyl-CoA derivative, (S)-2-methylbutyryl-CoA, but also reacts significantly with other 2-methyl branched chain substrates and with short straight chain acyl-CoAs. The cDNA encodes for a mitochondrial precursor protein which is cleaved upon mitochondrial import and predicted to yield a mature peptide of approximately 43.7-KDa.
branched chain acyl-CoA dehydrogenase(ACADSB) is a member of the acyl-CoA dehydrogenase family of enzymes that catalyze the dehydrogenation of acyl-CoA derivatives in the metabolism of fatty acids or branch chained amino acids. Substrate specificity is the primary characteristic used to define members of this gene family. The ACADSB gene product has the greatest activity towards the short branched chain acyl-CoA derivative, (S)-2-methylbutyryl-CoA, but also reacts significantly with other 2-methyl branched chain substrates and with short straight chain acyl-CoAs. The cDNA encodes for a mitochondrial precursor protein which is cleaved upon mitochondrial import and predicted to yield a mature peptide of approximately 43.7-KDa.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
47,874 Da
NCBI Official Full Name
short/branched chain specific acyl-CoA dehydrogenase, mitochondrial
NCBI Official Synonym Full Names
acyl-Coenzyme A dehydrogenase, short/branched chain
NCBI Official Symbol
Acadsb
NCBI Official Synonym Symbols
SBCAD; 2-MEBCAD; BB066609; 1300003O09Rik
NCBI Protein Information
short/branched chain specific acyl-CoA dehydrogenase, mitochondrial
UniProt Protein Name
Short/branched chain specific acyl-CoA dehydrogenase, mitochondrial
Protein Family
UniProt Gene Name
Acadsb
UniProt Synonym Gene Names
SBCAD; 2-MEBCAD; 2-methylbutyryl-CoA dehydrogenase
Uniprot Description
Has greatest activity toward short branched chain acyl-CoA derivative such as (s)-2-methylbutyryl-CoA, isobutyryl-CoA, and 2-methylhexanoyl-CoA as well as toward short straight chain acyl-CoAs such as butyryl-CoA and hexanoyl-CoA. Can use valproyl-CoA as substrate and may play a role in controlling the metabolic flux of valproic acid in the development of toxicity of this agent ().
Similar Products
Product Notes
The Acadsb acadsb (Catalog #AAA1465311) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 34-432, full length protein. The amino acid sequence is listed below: KSSQPEALVS LTNNAVAFAP LQTLTDEEIM MKQTVKKFAQ EHVAPLVSSM DENSKMEKSV IQGLFQQGLM GIEVEAQYGG TEASFFCSVL VIEELAKVDA SVALLCDIQN TIINNLFRKH ASEEQKATYL PKLVTEKLGS FCLSEAGAGS DSFAMKTRAD KSGNYYVLNG SKMWISHAEH AELFLVFANV DPSSGYRGIT CFLVDRDTEG FQIGKRENKM GIRASSTCQL TFENVKVPET NILGKIGHGY KYAIGSLNEG RIGIAAQMLG LAQGCFDYTI PYIKERMQFG KRIFDFQGLQ HQVAQVATQL EATRLLTYNA ARLVEAGRPF IKEASMAKYY ASEVAGLTTS KCIEWMGGVG YTKDYPVEKF FRDAKIGTIY EGASNIQLNT IAKHIDAEY. It is sometimes possible for the material contained within the vial of "Short/branched chain specific acyl-CoA dehydrogenase, mitochondrial (Acadsb), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
