Pachytene checkpoint protein 2 homolog (trip13) Recombinant Protein | trip13 recombinant protein
Recombinant Xenopus tropicalis Pachytene checkpoint protein 2 homolog (trip13)
Gene Names
trip13; pch2; 16e1bp; trip-13
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Pachytene checkpoint protein 2 homolog (trip13); Recombinant Xenopus tropicalis Pachytene checkpoint protein 2 homolog (trip13); trip13 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-432, Full length protein
Sequence
MDEVAVDLKQALPNVYNNLQVHVDVHQKSNSPATSQDIQSHVMQLLNRHCVVFGDYSWTEFDDSFLMKNIHSISIADTELKLKDRQPIDLSKCKVLIHIFQLNEDGPCVESLEEENEDLVAANHWLLPAADFHGLWDSLIYDSEIKSRLLDYIETAMLFSDKNVDSNLISWNRVVLLHGPPGTGKTSLCKALAQKLTIRLSYRYRYGQLVEINSHSLFSKWFSESGKLVTKMFQKIHELINDKEALVFVLIDEVESLTAARKASRAGTEPSDAIRVVNAVLTQIDHIKRYPNVVILSTSNLTEKIDVAFTDRADIKQYIGPPSPAAIFKIYLSCIEELMKCQIIYPKQQLLTLRDLEIIGFLENNISKLSLQLNEISRKSEGLSGRVLRKLPFLAHALYLQSPTVTIERFLWALSLAVDEQFQERKNFSENI
Sequence Length
432
Species
Xenopus tropicalis (Western clawed frog) (Silurana tropicalis)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
49,243 Da
NCBI Official Full Name
pachytene checkpoint protein 2 homolog
NCBI Official Synonym Full Names
thyroid hormone receptor interactor 13
NCBI Official Symbol
trip13
NCBI Official Synonym Symbols
pch2; 16e1bp; trip-13
NCBI Protein Information
pachytene checkpoint protein 2 homolog
UniProt Protein Name
Pachytene checkpoint protein 2 homolog
UniProt Gene Name
trip13
UniProt Synonym Gene Names
pch2; TR-interacting protein 13 homolog; TRIP-13 homolog
Uniprot Description
Plays a key role in chromosome recombination and chromosome structure development during meiosis. Required at early steps in meiotic recombination that leads to non-crossovers pathways. Also needed for efficient completion of homologous synapsis by influencing crossover distribution along the chromosomes affecting both crossovers and non-crossovers pathways ().
Similar Products
Product Notes
The trip13 trip13 (Catalog #AAA1464630) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-432, Full length protein. The amino acid sequence is listed below: MDEVAVDLKQ ALPNVYNNLQ VHVDVHQKSN SPATSQDIQS HVMQLLNRHC VVFGDYSWTE FDDSFLMKNI HSISIADTEL KLKDRQPIDL SKCKVLIHIF QLNEDGPCVE SLEEENEDLV AANHWLLPAA DFHGLWDSLI YDSEIKSRLL DYIETAMLFS DKNVDSNLIS WNRVVLLHGP PGTGKTSLCK ALAQKLTIRL SYRYRYGQLV EINSHSLFSK WFSESGKLVT KMFQKIHELI NDKEALVFVL IDEVESLTAA RKASRAGTEP SDAIRVVNAV LTQIDHIKRY PNVVILSTSN LTEKIDVAFT DRADIKQYIG PPSPAAIFKI YLSCIEELMK CQIIYPKQQL LTLRDLEIIG FLENNISKLS LQLNEISRKS EGLSGRVLRK LPFLAHALYL QSPTVTIERF LWALSLAVDE QFQERKNFSE NI. It is sometimes possible for the material contained within the vial of "Pachytene checkpoint protein 2 homolog (trip13), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
