Vascular Endothelial Growth Factor C HEK Recombinant Protein | VEGFC recombinant protein

Recombinant Human Vascular Endothelial Growth Factor C HEK

Cat. Num. AAA146269

• Gene Names: VEGFC; VRP; Flt4-L; LMPH1D
• Purity: Greater than 95% as determined by SDS-PAGE.
• Synonyms: Vascular Endothelial Growth Factor C HEK; Recombinant Human Vascular Endothelial Growth Factor C HEK; VEGFC Human HEK; Vascular Endothelial Growth Factor C Human Recombinant HEK; VEGF-C; Vascular endothelial growth factor C; VRP; Flt4 ligand; Flt4-L; Vascular endothelial growth factor-related protein; VEGFC; VEGFC HEK; VEGFC recombinant protein

• Host: HEK293 Cells
• Purity/Purification: Greater than 95% as determined by SDS-PAGE.
• Form/Format: VEGFC was lyophilized from a 0.2 uM filtered solution of 20mM Tris-HCl and 150mM NaCl, pH 7.2.; Sterile Filtered White lyophilized (freeze-dried) powder.
• Sequence: FESGLDLSDAEPDAGEATAYASKDLEEQLRSVSSVDELMTVLYPEYWKMYKCQLRKGGWQHNREQANLNSRTEETIKFAAAHYNTEILKSIDNEWRKTQCMPREVCIDVGKEFGVATNTFFKPPCVSVYRCGGCCNSEGQCMNTSTSYLSKTLFEITVPLSQGPKPVTISFANHTSCRCMSKLDVYRQVHSIIRRVDHHHHHH
• Sequence Length: 419

• Solubility: It is recommended to reconstitute the lyophilized VEGFC in 1xPBS to a concentration no less than 100 ug/ml, which can then be further diluted to other aqueous solutions.

Related Product Information for VEGFC recombinant protein

Description: VEGFC Human Recombinant produced by transfected human cells is a single polypeptide chain containing 204 amino acids (32-227). VEGFC is fused to an 8 amino acid His-tag at C-terminus & purified by proprietary chromatographic techniques.

Introduction: VEGF-C, also known as Vascular Endothelial Growth Factor Related Protein (VRP), is a recently discovered VEGF growth factor family member that is most closely related to VEGF-D. Human VEGF-C cDNA encodes a pre-pro-protein of 416 amino acids residues. It is almost identical to the mouse VEGF-C protein. Similar to VEGF-D, VEGF-C has a VEGF homology domain spanning the middle third of the precursor molecule and long N- and C-terminal extensions. In adults, VEGF-C is highly expressed in heart, placenta, ovary and small intestine. Recombinant human VEGF-C, lacking the N- and C-terminal extensions and containing only the middle VEGF homology domain, forms primarily non-covalently linked dimers. This proteinis a ligand for both VEGFR-2/KDR and VEGFR-3/FLT-4. Since VEGFR-3 is strongly expressed in lymphatic endothelial cells, it has been postulated that VEGF-C is involved in the regulation of the growth and/or differentiation of lymphatic endothelium. Although recombinant human VEGF-C is also a mitogen for vascularendothelial cells, it is much less potent than VEGF-A.

Product Categories/Family for VEGFC recombinant protein

Cytokines and Growth Factors; Growth Factors; VEGF

NCBI and Uniprot Product Information

• NCBI GI #: 4885653
• NCBI GeneID: 7424
• NCBI Accession #: NP_005420.1
• NCBI GenBank Nucleotide #: NM_005429.4
• UniProt Accession #: P49767; B2R9Q8
• Molecular Weight: 46,883 Da
• NCBI Official Full Name: vascular endothelial growth factor C preproprotein
• NCBI Official Synonym Full Names: vascular endothelial growth factor C
• NCBI Official Symbol: VEGFC
• NCBI Official Synonym Symbols: VRP; Flt4-L; LMPH1D
• NCBI Protein Information: vascular endothelial growth factor C; FLT4 ligand DHM; vascular endothelial growth factor-related protein
• UniProt Protein Name: Vascular endothelial growth factor C
• Protein Family: Vascular endothelial growth factor
• UniProt Gene Name: VEGFC
• UniProt Synonym Gene Names: VEGF-C; Flt4-L; VRP
• UniProt Entry Name: VEGFC_HUMAN

NCBI Description

The protein encoded by this gene is a member of the platelet-derived growth factor/vascular endothelial growth factor (PDGF/VEGF) family. The encoded protein promotes angiogenesis and endothelial cell growth, and can also affect the permeability of blood vessels. The proprotein is further cleaved into a fully processed form that can bind and activate VEGFR-2 and VEGFR-3 receptors. [provided by RefSeq, Apr 2014]

Uniprot Description

VEGFC: Growth factor active in angiogenesis, and endothelial cell growth, stimulating their proliferation and migration and also has effects on the permeability of blood vessels. May function in angiogenesis of the venous and lymphatic vascular systems during embryogenesis, and also in the maintenance of differentiated lymphatic endothelium in adults. Binds and activates VEGFR-2 (KDR/FLK1) and VEGFR-3 (FLT4) receptors. Homodimer; non-covalent and antiparallel. Spleen, lymph node, thymus, appendix, bone marrow, heart, placenta, ovary, skeletal muscle, prostate, testis, colon and small intestine and fetal liver, lung and kidney, but not in peripheral blood lymphocyte. Belongs to the PDGF/VEGF growth factor family.

Protein type: Motility/polarity/chemotaxis; Cell cycle regulation; Secreted; Secreted, signal peptide; Cytokine

Chromosomal Location of Human Ortholog: 4q34.3

Cellular Component: extracellular space; membrane; extracellular region

Molecular Function: protein binding; growth factor activity; vascular endothelial growth factor receptor 3 binding; chemoattractant activity

Biological Process: signal transduction; induction of positive chemotaxis; negative regulation of cell proliferation; platelet degranulation; morphogenesis of embryonic epithelium; positive chemotaxis; regulation of vascular endothelial growth factor receptor signaling pathway; positive regulation of cell proliferation; angiogenesis; negative regulation of blood pressure; positive regulation of cell-matrix adhesion; response to drug; substrate-bound cell migration; platelet activation; positive regulation of neuroblast proliferation; positive regulation of blood vessel endothelial cell migration; positive regulation of protein amino acid autophosphorylation; positive regulation of angiogenesis; organ morphogenesis; positive regulation of peptidyl-tyrosine phosphorylation; positive regulation of protein secretion; positive regulation of cell division; blood coagulation; vascular endothelial growth factor receptor signaling pathway; positive regulation of epithelial cell proliferation

Disease: Lymphedema, Hereditary, Id