Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Forkhead box protein C1-A (foxc1-a) Recombinant Protein | foxc1-a recombinant protein

Recombinant Xenopus laevis Forkhead box protein C1-A (foxc1-a)

Gene Names
foxc1-A; XFD-11
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Forkhead box protein C1-A (foxc1-a); Recombinant Xenopus laevis Forkhead box protein C1-A (foxc1-a); foxc1-a recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-492, Full length protein
Sequence
MQARYSVSSPNSLGVVPYLSGEQSYYRAAAAAAAAGGGYTGMAAPMSMYSHPAHEQYQAGMARAYGPYTPQPQPKDMVKPPYSYIALITMAIQNAPDKKITLNGIYQFIMERFPFYRDNKQGWQNSIRHNLSLNECFVKVPRDDKKPGKGSYWTLDPDSYNMFENGSFLRRRRRFKKKDVSKDATKEDKERLLKEHHGSQSAAAQQQRQQQQSQAQAEQDSNSQPVRIQDIKTENGTSSPPQSMSPALSAVPKIESPDSSSSMSSGSPHSIPSNRSMSLEAAESHHPHHQQHSQGFSVDNIMTSLRGSPQGSAELPSPLISSSRTGIAPSLSLSYSPGQGSIYSSPCSQGTSSGGGAGTYHCNMQAMSLYSGDRSGHLTPANTPAATTVEETLPDYSISTTSAQSHGNQEHPHQGRLPSWYLNQTGELGHLAGATYPGQQQNFHSVREMFESQRLALNSSPVNGNSSCQMSFPPSQSLYRTSGAFVYDCSKF
Sequence Length
492
Species
Xenopus laevis (African clawed frog)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
53,674 Da
NCBI Official Full Name
winged helix transcription factor XFD-11
NCBI Official Symbol
foxc1-A
NCBI Official Synonym Symbols
XFD-11
NCBI Protein Information
winged helix transcription factor XFD-11
UniProt Protein Name
Forkhead box protein C1-A
Protein Family
UniProt Gene Name
foxc1-a
UniProt Synonym Gene Names
foxc1; XFD-11

Uniprot Description

DNA-binding transcriptional factor that plays a role in a broad range of cellular and developmental processes such as eye, bones, cardiovascular, kidney and skin development. Acts either as a transcriptional activator or repressor. Binds to the consensus binding site 5'-[G/C][A/T]AAA[T/C]AA[A/C]-3' in promoter of target genes. Upon DNA-binding, promotes DNA bending. Required for cell viability and resistance to oxidative stress in the eye. Promotes cell growth inhibition by stopping the cell cycle in the G1 phase through TGFB1-mediated signals. Involved in epithelial-mesenchymal transition (EMT) induction by increasing cell proliferation, migration and invasion. Involved in chemokine-induced endothelial cell migration. Plays a role in epidermal keratinocyte terminal differentiation. Essential developmental transcriptional factor required for mesoderm-derived tissues formation, such as the somites, skin, bone and cartilage. Plays a role in the development and maintenance of mesenchymal niches for haematopoietic stem and progenitor cells (HSPC). Plays a role in corneal transparency by preventing both blood vessel and lymphatic vessel growth during embryonic development in a VEGF-dependent manner (). Plays a role at the gastrula stage for expression of several mesodermal and endodermal genes (PubMed:17705306). At the late neurula stage, regulates expression of adhesion genes to maintain cell adhesion in the mesodermal germ layer (PubMed:17705306).

Research Articles on foxc1-a

Similar Products

Product Notes

The foxc1-a foxc1-a (Catalog #AAA1459245) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-492, Full length protein. The amino acid sequence is listed below: MQARYSVSSP NSLGVVPYLS GEQSYYRAAA AAAAAGGGYT GMAAPMSMYS HPAHEQYQAG MARAYGPYTP QPQPKDMVKP PYSYIALITM AIQNAPDKKI TLNGIYQFIM ERFPFYRDNK QGWQNSIRHN LSLNECFVKV PRDDKKPGKG SYWTLDPDSY NMFENGSFLR RRRRFKKKDV SKDATKEDKE RLLKEHHGSQ SAAAQQQRQQ QQSQAQAEQD SNSQPVRIQD IKTENGTSSP PQSMSPALSA VPKIESPDSS SSMSSGSPHS IPSNRSMSLE AAESHHPHHQ QHSQGFSVDN IMTSLRGSPQ GSAELPSPLI SSSRTGIAPS LSLSYSPGQG SIYSSPCSQG TSSGGGAGTY HCNMQAMSLY SGDRSGHLTP ANTPAATTVE ETLPDYSIST TSAQSHGNQE HPHQGRLPSW YLNQTGELGH LAGATYPGQQ QNFHSVREMF ESQRLALNSS PVNGNSSCQM SFPPSQSLYR TSGAFVYDCS KF. It is sometimes possible for the material contained within the vial of "Forkhead box protein C1-A (foxc1-a), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.