Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-PAGE

Tumor necrosis factor receptor superfamily member 25 (TNFRSF25) Recombinant Protein | TNFRSF25 recombinant protein

Recombinant Human Tumor necrosis factor receptor superfamily member 25 (TNFRSF25)

Gene Names
TNFRSF25; DR3; TR3; DDR3; LARD; APO-3; TRAMP; WSL-1; WSL-LR; TNFRSF12
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Tumor necrosis factor receptor superfamily member 25 (TNFRSF25); Recombinant Human Tumor necrosis factor receptor superfamily member 25 (TNFRSF25); Tumor necrosis factor receptor superfamily member 25; Apo-3; Apoptosis-inducing receptor AIR; Apoptosis-mediating receptor DR3; Apoptosis-mediating receptor TRAMP; Death receptor 3; Lymphocyte-associated receptor of death; LARD; Protein WSL; Protein WSL-1; TNFRSF25 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
25-199aa; Extracellular Domain
Sequence
QGGTRSPRCDCAGDFHKKIGLFCCRGCPAGHYLKAPCTEPCGNSTCLVCPQDTFLAWENHHNSECARCQACDEQASQVALENCSAVADTRCGCKPGWFVECQVSQCVSSSPFYCQPCLDCGALHRHTRLLCSRRDTDCGTCLPGFYEHGDGCVSCPTSTLGSCPERCAAVCGWRQ
Sequence Length
175
Species
Homo sapiens (Human)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

SDS-PAGE

SDS-PAGE
Related Product Information for TNFRSF25 recombinant protein
Receptor for TNFSF12/APO3L/TWEAK. Interacts directly with the adapter TRADD. Mediates activation of NF-kappa-B and induces apoptosis. May play a role in regulating lymphocyte homeostasis.
Product Categories/Family for TNFRSF25 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
22.9 kDa
NCBI Official Full Name
tumor necrosis factor receptor superfamily member 25 isoform 12
NCBI Official Synonym Full Names
tumor necrosis factor receptor superfamily, member 25
NCBI Official Symbol
TNFRSF25
NCBI Official Synonym Symbols
DR3; TR3; DDR3; LARD; APO-3; TRAMP; WSL-1; WSL-LR; TNFRSF12
NCBI Protein Information
tumor necrosis factor receptor superfamily member 25; protein WSL-1; death receptor beta; apoptosis inducing receptor; apoptosis-inducing receptor AIR; apoptosis-mediating receptor DR3; apoptosis-mediating receptor TRAMP; death domain receptor 3 soluble form; lymphocyte-associated receptor of death; tumor necrosis factor receptor superfamily, member 12 (translocating chain-association membrane protein)
UniProt Protein Name
Tumor necrosis factor receptor superfamily member 25
UniProt Gene Name
TNFRSF25
UniProt Synonym Gene Names
APO3; DDR3; DR3; TNFRSF12; WSL; WSL1; LARD
UniProt Entry Name
TNR25_HUMAN

NCBI Description

The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor is expressed preferentially in the tissues enriched in lymphocytes, and it may play a role in regulating lymphocyte homeostasis. This receptor has been shown to stimulate NF-kappa B activity and regulate cell apoptosis. The signal transduction of this receptor is mediated by various death domain containing adaptor proteins. Knockout studies in mice suggested the role of this gene in the removal of self-reactive T cells in the thymus. Multiple alternatively spliced transcript variants of this gene encoding distinct isoforms have been reported, most of which are potentially secreted molecules. The alternative splicing of this gene in B and T cells encounters a programmed change upon T-cell activation, which predominantly produces full-length, membrane bound isoforms, and is thought to be involved in controlling lymphocyte proliferation induced by T-cell activation. [provided by RefSeq, Jul 2008]

Uniprot Description

TNFRSF25: Receptor for TNFSF12/APO3L/TWEAK. Interacts directly with the adapter TRADD. Mediates activation of NF-kappa-B and induces apoptosis. May play a role in regulating lymphocyte homeostasis. Homodimer. Interacts strongly via the death domains with TNFRSF1 and TRADD to activate at least two distinct signaling cascades, apoptosis and NF-kappa-B signaling. Interacts with BAG4. Abundantly expressed in thymocytes and lymphocytes. Detected in lymphocyte-rich tissues such as thymus, colon, intestine, and spleen. Also found in the prostate. 12 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral; Receptor, misc.; Apoptosis

Chromosomal Location of Human Ortholog: 1p36.2

Cellular Component: integral to plasma membrane; plasma membrane; extracellular region; cytosol

Molecular Function: tumor necrosis factor receptor activity; receptor activity

Biological Process: regulation of apoptosis; cell surface receptor linked signal transduction; tumor necrosis factor-mediated signaling pathway; apoptosis; signal transduction

Research Articles on TNFRSF25

Similar Products

Product Notes

The TNFRSF25 tnfrsf25 (Catalog #AAA1456449) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 25-199aa; Extracellular Domain. The amino acid sequence is listed below: QGGTRSPRCD CAGDFHKKIG LFCCRGCPAG HYLKAPCTEP CGNSTCLVCP QDTFLAWENH HNSECARCQA CDEQASQVAL ENCSAVADTR CGCKPGWFVE CQVSQCVSSS PFYCQPCLDC GALHRHTRLL CSRRDTDCGT CLPGFYEHGD GCVSCPTSTL GSCPERCAAV CGWRQ. It is sometimes possible for the material contained within the vial of "Tumor necrosis factor receptor superfamily member 25 (TNFRSF25), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.