3'-5' exoribonuclease 1 (Eri1) Recombinant Protein | Eri1 recombinant protein
Recombinant Rat 3'-5' exoribonuclease 1 (Eri1)
Gene Names
Eri1; Thex1; RGD1308378
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
3'-5' exoribonuclease 1 (Eri1); Recombinant Rat 3'-5' exoribonuclease 1 (Eri1); Eri1 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-345, full length protein
Sequence
MEDERGREHGGDAAQQKTPRPECEESRPLSVEKKQRCRLDGKDTDGSKFITSNGGDFSDPVYKEIAMTNGCINRMSKEELRAKLSEFKLETRGVKDVLKKRLKNYYKKQKLMLKESNAVDSYYDYICIIDFEATCEEGNPAEFLHEIIEFPVVLLNTHSLEIEDTFQQYVRPEVNSQLSEFCIGLTGITQDQVDRADAFPQVLKKVIEWMKSKELGTKYKYCILTDGSWDMSKFLNIQCQLSRLKYPSFAKKWINIRKSYGNFYKVPRSQTKLTIMLEKLGMDYDGRPHSGLDDSKNIARIAVRMLQDGCELRINEKLHGGQLMSVSSSLPVEGAPAPQMPHSRK
Sequence Length
345
Species
Rat
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
39,580 Da
NCBI Official Full Name
3'-5' exoribonuclease 1
NCBI Official Synonym Full Names
exoribonuclease 1
NCBI Official Symbol
Eri1
NCBI Official Synonym Symbols
Thex1; RGD1308378
NCBI Protein Information
3'-5' exoribonuclease 1
UniProt Protein Name
3'-5' exoribonuclease 1
Protein Family
UniProt Gene Name
Eri1
UniProt Synonym Gene Names
Thex1
Uniprot Description
RNA exonuclease that binds to the 3'-end of histone mRNAs and degrades them, suggesting that it plays an essential role in histone mRNA decay after replication. A 2' and 3'-hydroxyl groups at the last nucleotide of the histone 3'-end is required for efficient degradation of RNA substrates. Also able to degrade the 3'-overhangs of short interfering RNAs (siRNAs) in vitro, suggesting a possible role as regulator of RNA interference (RNAi). Binds with high affinity to the 3' side of the stem-loop structure and to the downstream cleavage product (DCP) of histone pre-mRNAs. Requires for binding the 5'-ACCCA-3' sequence present in stem-loop structure. Able to bind other mRNAs. Required for 5.8S rRNA 3'-end processing. Also binds to 5.8s ribosomal RNA ().
Similar Products
Product Notes
The Eri1 eri1 (Catalog #AAA1455603) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-345, full length protein. The amino acid sequence is listed below: MEDERGREHG GDAAQQKTPR PECEESRPLS VEKKQRCRLD GKDTDGSKFI TSNGGDFSDP VYKEIAMTNG CINRMSKEEL RAKLSEFKLE TRGVKDVLKK RLKNYYKKQK LMLKESNAVD SYYDYICIID FEATCEEGNP AEFLHEIIEF PVVLLNTHSL EIEDTFQQYV RPEVNSQLSE FCIGLTGITQ DQVDRADAFP QVLKKVIEWM KSKELGTKYK YCILTDGSWD MSKFLNIQCQ LSRLKYPSFA KKWINIRKSY GNFYKVPRSQ TKLTIMLEKL GMDYDGRPHS GLDDSKNIAR IAVRMLQDGC ELRINEKLHG GQLMSVSSSL PVEGAPAPQM PHSRK. It is sometimes possible for the material contained within the vial of "3'-5' exoribonuclease 1 (Eri1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
