Alpha-tubulin N-acetyltransferase 2 (CG17003) Recombinant Protein | CG17003 recombinant protein
Recombinant Drosophila melanogaster Alpha-tubulin N-acetyltransferase 2 (CG17003)
Gene Names
CG17003; DmelCG17003
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Alpha-tubulin N-acetyltransferase 2 (CG17003); Recombinant Drosophila melanogaster Alpha-tubulin N-acetyltransferase 2 (CG17003); CG17003 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-287, Full length protein
Sequence
MVEFAFDIKHLFPQSIIRVQAHSLRPKVTQCRRYAQTERGKSTMTSCRLSEILNIMGKLSADAQGLCHAVTSADKLASDQVVYLMADKAAGHWEITGLLKVGTKDLFVFDQGGCYRRLNQTPAILDFYVHESRQRCGQGKLLFEWMLEKQGWSAHKCTVDRPSNKMLAFMAKHYGLVRTIPQGNNFVLYEGFFDDPITTCKSASGLQATGSGCRSRSQGHYVRQEQDQAQIKHGQANRNTVQNDANSGPFRQDQKIVVGTSIYRRRWKSPRTLARAGCREVSGGRRF
Sequence Length
287
Species
Drosophila melanogaster (Fruit fly)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
32,383 Da
NCBI Official Full Name
uncharacterized protein Dmel_CG17003
NCBI Official Symbol
CG17003
NCBI Official Synonym Symbols
DmelCG17003
NCBI Protein Information
CG17003 gene product from transcript CG17003-RA
UniProt Protein Name
Alpha-tubulin N-acetyltransferase 2
UniProt Gene Name
CG17003
UniProt Synonym Gene Names
Alpha-TAT 2; TAT 2
Uniprot Description
Specifically acetylates 'Lys-40' in alpha-tubulin on the lumenal side of microtubules. Promotes microtubule destabilization and accelerates microtubule dynamics; this activity may be independent of acetylation activity. Acetylates alpha-tubulin with a slow enzymatic rate, due to a catalytic site that is not optimized for acetyl transfer. Enters the microtubule through each end and diffuses quickly throughout the lumen of microtubules. Acetylates only long/old microtubules because of its slow acetylation rate since it does not have time to act on dynamically unstable microtubules before the enzyme is released.
Similar Products
Product Notes
The CG17003 cg17003 (Catalog #AAA1454322) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-287, Full length protein. The amino acid sequence is listed below: MVEFAFDIKH LFPQSIIRVQ AHSLRPKVTQ CRRYAQTERG KSTMTSCRLS EILNIMGKLS ADAQGLCHAV TSADKLASDQ VVYLMADKAA GHWEITGLLK VGTKDLFVFD QGGCYRRLNQ TPAILDFYVH ESRQRCGQGK LLFEWMLEKQ GWSAHKCTVD RPSNKMLAFM AKHYGLVRTI PQGNNFVLYE GFFDDPITTC KSASGLQATG SGCRSRSQGH YVRQEQDQAQ IKHGQANRNT VQNDANSGPF RQDQKIVVGT SIYRRRWKSP RTLARAGCRE VSGGRRF. It is sometimes possible for the material contained within the vial of "Alpha-tubulin N-acetyltransferase 2 (CG17003), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
