Zinc finger E-box-binding homeobox 1 (Zeb1) Recombinant Protein | Zeb1 recombinant protein
Recombinant Mouse Zinc finger E-box-binding homeobox 1 (Zeb1) , partial
Gene Names
Zeb1; Tw; BZP; ZEB; MEB1; Nil2; Tcf8; AREB6; TCF-8; Tcf18; Zfhep; Zfx1a; Zfhx1a; Zfx1ha; [delta]EF1; 3110032K11Rik
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Zinc finger E-box-binding homeobox 1 (Zeb1); Recombinant Mouse Zinc finger E-box-binding homeobox 1 (Zeb1); partial; Zeb1 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-217. partial.
Sequence
MADGPRCKRRKQANPRRNNVTNYNTVVEANSDSDDEDKLHIVEEESITDAADCEGGMPDDELPADQTVLPGGSDRGGGAKNCWQDNVKDNECDSDAENEQNHDPNVEEFLQQQDTAVIYPEAPEEDQRQGTPEASSHDENGTPDAFSQLLTCPYCDRGYKRFTSLKEHIKYRHEKNEDNFSCSLCSYTFAYRTQLERHMTSHKSGREQRHVTQSGGN
Sequence Length
217
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
122,465 Da
NCBI Official Full Name
zinc finger E-box-binding homeobox 1 isoform 1
NCBI Official Synonym Full Names
zinc finger E-box binding homeobox 1
NCBI Official Symbol
Zeb1
NCBI Official Synonym Symbols
Tw; BZP; ZEB; MEB1; Nil2; Tcf8; AREB6; TCF-8; Tcf18; Zfhep; Zfx1a; Zfhx1a; Zfx1ha; [delta]EF1; 3110032K11Rik
NCBI Protein Information
zinc finger E-box-binding homeobox 1
UniProt Protein Name
Zinc finger E-box-binding homeobox 1
Protein Family
UniProt Gene Name
Zeb1
UniProt Synonym Gene Names
Tcf8; Zfhx1a; Zfx1a; Zfx1ha; TCF-8; MEB1
Uniprot Description
Acts as a transcriptional repressor. Binds to E-box sequences in the immunoglobulin heavy chain enhancer as well as in the regulatory regions of many other tissue-specific genes. Represses E-cadherin promoter and induces an epithelial-mesenchymal transition (EMT) by recruiting SMARCA4/BRG1. Represses BCL6 transcription in the presence of the corepressor CTBP1 (). Positively regulates neuronal differentiation. Represses RCOR1 transcription activation during neurogenesis. Represses transcription by binding to the E box (5'-CANNTG-3'). Promotes tumorigenicity by repressing stemness-inhibiting microRNAs.
Research Articles on Zeb1
Similar Products
Product Notes
The Zeb1 zeb1 (Catalog #AAA1452810) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-217. partial. The amino acid sequence is listed below: MADGPRCKRR KQANPRRNNV TNYNTVVEAN SDSDDEDKLH IVEEESITDA ADCEGGMPDD ELPADQTVLP GGSDRGGGAK NCWQDNVKDN ECDSDAENEQ NHDPNVEEFL QQQDTAVIYP EAPEEDQRQG TPEASSHDEN GTPDAFSQLL TCPYCDRGYK RFTSLKEHIK YRHEKNEDNF SCSLCSYTFA YRTQLERHMT SHKSGREQRH VTQSGGN. It is sometimes possible for the material contained within the vial of "Zinc finger E-box-binding homeobox 1 (Zeb1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
