Glycolipid transfer protein domain-containing protein 1 (Gltpd1) Recombinant Protein | Gltpd1 recombinant protein
Recombinant Rat Glycolipid transfer protein domain-containing protein 1 (Gltpd1)
Gene Names
Cptp; Gltpd1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Glycolipid transfer protein domain-containing protein 1 (Gltpd1); Recombinant Rat Glycolipid transfer protein domain-containing protein 1 (Gltpd1); Gltpd1 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-216, full length protein
Sequence
MDGPERDFNLKVVLISFKKCLTDKGEVLLDHYTASWKGLVRFLNSLGAVFSFISKDVVSKLQIMEHLRSGPQSEHYISLQSMVAYEVSNKLVDRDSRSRPRHPNSGCRTVLRLHRALHWLQLFLEGLRTSSEDARTSTLCSEAYNATLAAYHSWIVRQAVNVAFHALPPRKVFLEAMNMGSSEQAVEMLGEALPFIEQVYDISQKLYAEHSLLDLP
Sequence Length
216
Species
Rat
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
24,522 Da
NCBI Official Full Name
ceramide-1-phosphate transfer protein
NCBI Official Synonym Full Names
ceramide-1-phosphate transfer protein
NCBI Official Symbol
Cptp
NCBI Official Synonym Symbols
Gltpd1
NCBI Protein Information
ceramide-1-phosphate transfer protein
UniProt Protein Name
Ceramide-1-phosphate transfer protein
UniProt Gene Name
Cptp
UniProt Synonym Gene Names
Gltpd1; CPTP
Uniprot Description
Mediates the intracellular transfer of ceramide-1-phosphate between organelle membranes and the cell membrane. Required for normal structure of the Golgi stacks. Can bind phosphoceramides with a variety of aliphatic chains, but has a preference for lipids with saturated C16:0 or monounsaturated C18:1 aliphatic chains, and is inefficient with phosphoceramides containing lignoceryl (C24:0). Plays a role in the regulation of the cellular levels of ceramide-1-phosphate, and thereby contributes to the regulation of phospholipase PLA2G4A activity and the release of arachidonic acid. Has no activity with galactosylceramide, lactosylceramide, sphingomyelin, phosphatidylcholine, phosphatidic acid and ceramide ().
Similar Products
Product Notes
The Gltpd1 cptp (Catalog #AAA1448188) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-216, full length protein. The amino acid sequence is listed below: MDGPERDFNL KVVLISFKKC LTDKGEVLLD HYTASWKGLV RFLNSLGAVF SFISKDVVSK LQIMEHLRSG PQSEHYISLQ SMVAYEVSNK LVDRDSRSRP RHPNSGCRTV LRLHRALHWL QLFLEGLRTS SEDARTSTLC SEAYNATLAA YHSWIVRQAV NVAFHALPPR KVFLEAMNMG SSEQAVEMLG EALPFIEQVY DISQKLYAEH SLLDLP. It is sometimes possible for the material contained within the vial of "Glycolipid transfer protein domain-containing protein 1 (Gltpd1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
