Src substrate cortactin (Cttn) Recombinant Protein | Cttn recombinant protein

Recombinant Mouse Src substrate cortactin (Cttn)

Cat. Num. AAA1440254

• Gene Names: Cttn; Ems1; 1110020L01Rik
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Src substrate cortactin (Cttn); Recombinant Mouse Src substrate cortactin (Cttn); Cttn recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-546, Full length protein
• Sequence: MWKASAGHAVSITQDDGGADDWETDPDFVNDVSEKEQRWGAKTVQGSGHQEHINIHKLRENVFQEHQTLKEKELETGPKASHGYGGKFGVEQDRMDRSAVGHEYQSKLSKHCSQVDSVRGFGGKFGVQMDRVDQSAVGFEYQGKTEKHASQKDYSSGFGGKYGVQADRVDKSAVGFDYQGKTEKHESQKDYSKGFGGKYGIDKDKVDKSAVGFEYQGKTEKHESQKDYVKGFGGKFGVQTDRQDKCALGWDHQEKLQLHESQKDYKTGFGGKFGVQSERQDSSAVGFDYKERLAKHESQQDYAKGFGGKYGVQKDRMDKNASTFEEVVQVPSAYQKTVPIEAVTSKTSNIRANFENLAKEREQEDRRKAEAERAQRMAKERQEQEEARRKLEEQARAKKQTPPASPSPQPIEDRPPSSPIYEDAAPFKAEPSYRGSEPEPEYSIEAAGIPEAGSQQGLTYTSEPVYETTEAPGHYQAEDDTYDGYESDLGITAIALYDYQAAGDDEISFDPDDIITNIEMIDDGWWRGVCKGRYGLFPANYVELRQ
• Sequence Length: 546

• Species: Mouse
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

Related Product Information for Cttn recombinant protein

This gene is overexpressed in breast cancer and squamous cell carcinomas of the head and neck. The encoded protein is localized in the cytoplasm and in areas of the cell-substratum contacts. This gene has two roles: (1) regulating the interactions between components of adherens-type junctions and (2) organizing the cytoskeleton and cell adhesion structures of epithelia and carcinoma cells. During apoptosis, the encoded protein is degraded in a caspase-dependent manner. The aberrant regulation of this gene contributes to tumor cell invasion and metastasis. Two splice variants that encode different isoforms have been identified for this gene.

NCBI and Uniprot Product Information

• NCBI GI #: 75677414
• NCBI GeneID: 13043
• NCBI Accession #: NP_031829.2
• NCBI GenBank Nucleotide #: NM_007803.5
• UniProt Accession #: Q60598; Q3UGC2
• Molecular Weight: 61,250 Da
• NCBI Official Full Name: src substrate cortactin isoform 1
• NCBI Official Synonym Full Names: cortactin
• NCBI Official Symbol: Cttn
• NCBI Official Synonym Symbols: Ems1; 1110020L01Rik
• NCBI Protein Information: src substrate cortactin
• UniProt Protein Name: Src substrate cortactin
• Protein Family: Src substrate cortactin
• UniProt Gene Name: Cttn
• UniProt Synonym Gene Names: Ems1

Uniprot Description

Contributes to the organization of the actin cytoskeleton and cell shape (PubMed:17403031). Plays a role in the formation of lamellipodia and in cell migration (). Plays a role in the regulation of neuron morphology, axon growth and formation of neuronal growth cones (). Through its interaction with CTTNBP2, involved in the regulation of neuronal spine density (PubMed:22262902). Plays a role in the invasiveness of cancer cells, and the formation of metastases (). Plays a role in focal adhesion assembly and turnover (). In complex with ABL1 and MYLK regulates cortical actin-based cytoskeletal rearrangement critical to sphingosine 1-phosphate (S1P)-mediated endothelial cell (EC) barrier enhancement (). Plays a role in intracellular protein transport and endocytosis, and in modulating the levels of potassium channels present at the cell membrane (PubMed:17959782). Plays a role in receptor-mediated endocytosis via clathrin-coated pits (). Required for stabilization of KCNH1 channels at the cell membrane ().