Glutathione S-transferase DHAR1, mitochondrial (DHAR1) Recombinant Protein | DHAR1 recombinant protein
Recombinant Arabidopsis thaliana Glutathione S-transferase DHAR1, mitochondrial (DHAR1)
Gene Names
DHAR1; ATDHAR1; dehydroascorbate reductase; DEHYDROASCORBATE REDUCTASE 5; DHAR5; F14P1.9; F14P1_9
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Glutathione S-transferase DHAR1; mitochondrial (DHAR1); Recombinant Arabidopsis thaliana Glutathione S-transferase DHAR1; DHAR1 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-213, Full length protein
Sequence
MALEICVKAAVGAPDHLGDCPFSQRALLTLEEKSLTYKIHLINLSDKPQWFLDISPQGKVPVLKIDDKWVTDSDVIVGILEEKYPDPPLKTPAEFASVGSNIFGTFGTFLKSKDSNDGSEHALLVELEALENHLKSHDGPFIAGERVSAVDLSLAPKLYHLQVALGHFKSWSVPESFPHVHNYMKTLFSLDSFEKTKTEEKYVISGWAPKVNP
Sequence Length
213
Species
Arabidopsis thaliana (Mouse-ear cress)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
23,455 Da
NCBI Official Full Name
dehydroascorbate reductase
NCBI Official Symbol
DHAR1
NCBI Official Synonym Symbols
ATDHAR1; dehydroascorbate reductase; DEHYDROASCORBATE REDUCTASE 5; DHAR5; F14P1.9; F14P1_9
NCBI Protein Information
dehydroascorbate reductase
UniProt Protein Name
Glutathione S-transferase DHAR1, mitochondrial
Protein Family
UniProt Gene Name
DHAR1
UniProt Synonym Gene Names
GSH-dependent dehydroascorbate reductase 1; mtDHAR
NCBI Description
Encodes a member of the dehydroascorbate reductase gene family. Critical for a mutualistic symbiosis between the host Arabidopsis and the root colonizing fungus Piriformospora indica.
Uniprot Description
Displays a dual function. As a soluble protein, exhibits glutathione-dependent thiol transferase and dehydroascorbate (DHA) reductase activities (PubMed:12077129). Key component of the ascorbate recycling system. Involved in the redox homeostasis, especially in scavenging of ROS under oxidative stresses, subsequently to biotic or abiotic inducers (PubMed:16262714). As a peripheral membrane protein, could also function as voltage-gated ion channel (PubMed:17267397).
Research Articles on DHAR1
Similar Products
Product Notes
The DHAR1 dhar1 (Catalog #AAA1439911) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-213, Full length protein. The amino acid sequence is listed below: MALEICVKAA VGAPDHLGDC PFSQRALLTL EEKSLTYKIH LINLSDKPQW FLDISPQGKV PVLKIDDKWV TDSDVIVGIL EEKYPDPPLK TPAEFASVGS NIFGTFGTFL KSKDSNDGSE HALLVELEAL ENHLKSHDGP FIAGERVSAV DLSLAPKLYH LQVALGHFKS WSVPESFPHV HNYMKTLFSL DSFEKTKTEE KYVISGWAPK VNP. It is sometimes possible for the material contained within the vial of "Glutathione S-transferase DHAR1, mitochondrial (DHAR1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
