Rab-like protein 2A (RABL2A) Recombinant Protein | RABL2A recombinant protein

Recombinant Human Rab-like protein 2A (RABL2A)

Cat. Num. AAA1439109

• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Rab-like protein 2A (RABL2A); Recombinant Human Rab-like protein 2A (RABL2A); RABL2A recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-228, Full length protein
• Sequence: MAEDKTKPSELDQGKYDADDNVKIICLGDSAVGKSKLMERFLMDGFQPQQLSTYALTLYKHTATVDGKTILVDFWDTAGQERFQSMHASYYHKAHACIMVFDIQRKVTYRNLSTWYTELREFRPEIPCIVVANKIDDINVTQKSFNFAKKFSLPLYFVSAADGTNVVKLFNDAIRLAVSYKQNSQDFMDEIFQELENFSLEQEEEDVPDQEQSSSIETPSEEVASPHS
• Sequence Length: 228

• Species: Human
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

Related Product Information for RABL2A recombinant protein

This gene is a member of the RAB gene family which belongs to the RAS GTPase superfamily. The proteins in the family of RAS-related signaling molecules are small GTP-binding proteins that play important roles in the regulation of exocytotic and endocytotic pathways. This gene maps to the site of an ancestral telomere fusion event and may be a subtelomeric gene. Two alternatively spliced transcript variants have been identified, both encoding the same protein.

NCBI and Uniprot Product Information

• NCBI GI #: 807201149
• NCBI GeneID: 11159
• NCBI Accession #: NP_001293089.1
• NCBI GenBank Nucleotide #: NM_001306160.2
• UniProt Accession #: Q9UBK7; Q9NU37; B7ZBD6
• Molecular Weight: 27,201 Da
• NCBI Official Full Name: rab-like protein 2A isoform 3
• NCBI Official Synonym Full Names: RAB, member of RAS oncogene family like 2A
• NCBI Official Symbol: RABL2A
• NCBI Protein Information: rab-like protein 2A
• UniProt Protein Name: Rab-like protein 2A
• UniProt Gene Name: RABL2A

NCBI Description

This gene is a member of the RAB gene family which belongs to the RAS GTPase superfamily. The proteins in the family of RAS-related signaling molecules are small GTP-binding proteins that play important roles in the regulation of exocytotic and endocytotic pathways. This gene maps to the site of an ancestral telomere fusion event and may be a subtelomeric gene. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Apr 2015]

Uniprot Description

Plays an essential role in male fertility, sperm intra-flagellar transport, and tail assembly. Binds, in a GTP-regulated manner, to a specific set of effector proteins including key proteins involved in cilia development and function and delivers them into the growing sperm tail.