Apoptosis 2 inhibitor (Iap2) Recombinant Protein | Iap2 recombinant protein
Recombinant Drosophila melanogaster Apoptosis 2 inhibitor (Iap2)
Gene Names
Diap2; CG8293; D-iap2; D-IAP2; dIAP; Diap; DIAP; Diap-2; DIAP-2; diap2; dIAP2; DIAP2; DIAPII; Diha; DIHA; dILP; DmelCG8293; IAP; Iap2; IAP2; Ilp
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Apoptosis 2 inhibitor (Iap2); Recombinant Drosophila melanogaster Apoptosis 2 inhibitor (Iap2); Iap2 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-498, Full length protein
Sequence
MTELGMELESVRLATFGEWPLNAPVSAEDLVANGFFATGNWLEAECHFCHVRIDRWEYGDQVAERHRRSSPICSMVLAPNHCGNVPRSQESDNEGNSVVDSPESCSCPDLLLEANRLVTFKDWPNPNITPQALAKAGFYYLNRLDHVKCVWCNGVIAKWEKNDNAFEEHKRFFPQCPRVQMGPLIEFATGKNLDELGIQPTTLPLRPKYACVDARLRTFTDWPISNIQPASALAQAGLYYQKIGDQVRCFHCNIGLRSWQKEDEPWFEHAKWSPKCQFVLLAKGPAYVSEVLATTAANASSQPATAPAPTLQADVLMDEAPAKEALALGIDGGVVRNAIQRKLLSSGCAFSTLDELLHDIFDDAGAGAALEVREPPEPSAPFIEPCQATTSKAASVPIPVADSIPAKPQAAEAVANISKITDEIQKMSVATPNGNLSLEEENRQLKDARLCKVCLDEEVGVVFLPCGHLATCNQCAPSVANCPMCRADIKGFVRTFLS
Sequence Length
498
Species
Drosophila melanogaster (Fruit fly)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
54,538 Da
NCBI Official Full Name
Death-associated inhibitor of apoptosis 2, isoform A
NCBI Official Synonym Full Names
Death-associated inhibitor of apoptosis 2
NCBI Official Symbol
Diap2
NCBI Official Synonym Symbols
CG8293; D-iap2; D-IAP2; dIAP; Diap; DIAP; Diap-2; DIAP-2; diap2; dIAP2; DIAP2; DIAPII; Diha; DIHA; dILP; DmelCG8293; IAP; Iap2; IAP2; Ilp
NCBI Protein Information
CG8293 gene product from transcript CG8293-RB
UniProt Protein Name
Death-associated inhibitor of apoptosis 2
Protein Family
UniProt Gene Name
Diap2
UniProt Synonym Gene Names
DIHA; Iap2; Ilp; ILP; dILP
Uniprot Description
Required for activation of NF-kappaB transcription factors in the immune deficiency (Imd) signaling cascade which is essential for innate immune responses upon infection by Gram-negative bacteria (PubMed:16894030, PubMed:17068333). Promotes cytoplasmic cleavage of Rel and its translocation to the nucleus where it drives expression of antimicrobial peptides (PubMed:17068333, PubMed:24374974). Binds, polyubiquitinates and activates Dredd which is required for Rel-mediated induction of antimicrobial peptides (PubMed:22549468). Anti-apoptotic protein which binds, ubiquitinates and inactivates the effector caspase Drice (PubMed:18166655). Suppresses rpr and hid-dependent cell death in the eye (PubMed:8548811). However, has also been shown to have little, if any, role in the regulation of the canonical caspase-dependent apoptosis pathway (PubMed:17068333). Plays a role in regulating the expression of ion channels (PubMed:24374974).
Research Articles on Iap2
1. cleaved protein retains the ability to interact with immune deficiency pathway signal transduction
Similar Products
Product Notes
The Iap2 diap2 (Catalog #AAA1438880) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-498, Full length protein. The amino acid sequence is listed below: MTELGMELES VRLATFGEWP LNAPVSAEDL VANGFFATGN WLEAECHFCH VRIDRWEYGD QVAERHRRSS PICSMVLAPN HCGNVPRSQE SDNEGNSVVD SPESCSCPDL LLEANRLVTF KDWPNPNITP QALAKAGFYY LNRLDHVKCV WCNGVIAKWE KNDNAFEEHK RFFPQCPRVQ MGPLIEFATG KNLDELGIQP TTLPLRPKYA CVDARLRTFT DWPISNIQPA SALAQAGLYY QKIGDQVRCF HCNIGLRSWQ KEDEPWFEHA KWSPKCQFVL LAKGPAYVSE VLATTAANAS SQPATAPAPT LQADVLMDEA PAKEALALGI DGGVVRNAIQ RKLLSSGCAF STLDELLHDI FDDAGAGAAL EVREPPEPSA PFIEPCQATT SKAASVPIPV ADSIPAKPQA AEAVANISKI TDEIQKMSVA TPNGNLSLEE ENRQLKDARL CKVCLDEEVG VVFLPCGHLA TCNQCAPSVA NCPMCRADIK GFVRTFLS. It is sometimes possible for the material contained within the vial of "Apoptosis 2 inhibitor (Iap2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
