Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Oncostatin-M Active Protein | OSM active protein

Recombinant Human Oncostatin-M (209 a.a.)

Purity
Greater than 97.0% as determined by(a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
Synonyms
Oncostatin-M; Recombinant Human Oncostatin-M (209 a.a.); OSM Human; 209 a.a; Oncostatin M Human Recombinant (209 a.a.); OSM; MGC20461; Oncostatin M; OSM (209 a.a.); OSM active protein
Ordering
For Research Use Only!
Host
E Coli
Purity/Purification
Greater than 97.0% as determined by(a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
Form/Format
Oncostatin-M (209 a.a.) was lyophilized from a concentrated (1mg/ml) solution containing 1x PBS pH-7.4.
Sterile Filtered White lyophilized (freeze-dried) powder.
Sequence
AAIGSCSKEYRVLLGQLQKQTDLMQDTSRLLDPYIRIQGLDVPKLREHCRERPGAFPSEETLRGLGRRGFLQTLNATLGCVLHRLADLEQRLPKAQDLERSGLNIEDLEKLQMARPNILGLRNNIYCMAQLLDNSDTAEPTKAGRGASQPPTPTPASDAFQRKLEGCRFLHGYHRFMHSVGRVFKWGESPNRSRRHSPHQALRKGVRR
Sequence Length
252
Solubility
It is recommended to reconstitute the lyophilized Oncostatin-M (209 a.a.) in sterile 18M Omega -cm H2O not less than 100 ug/ml, which can then be further diluted to other aqueous solutions.
Biological Activity
The ED50 as determined by the dose-dependant stimulation of Human TF-1 cells is < 2 ng/ml, corresponding to a Specific Activity of 500,000 IU/mg.
Preparation and Storage
Lyophilized Oncostatin-M (209 a.a.) although stable at room temperature for 3 weeks, should be stored desiccated below -18 degree C. Upon reconstitution Oncostatin-M (209 a.a.) should be stored at 4 degree C between 2-7 days and for future use below -18 degree C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles.
Related Product Information for OSM active protein
Description: Oncostatin-M (209 a.a.) Human Recombinant produced in E Coli is a single, non-glycosylated polypeptide chain containing 209 amino acids and having a molecular mass of 23.9kDa. The Oncostatin-M (209 a.a.) is purified by proprietary chromatographic techniques.

Introduction: Oncostatin M is a member of a cytokine family that includes leukemia-inhibitory factor, granulocyte colony-stimulating factor, and interleukin 6. This gene encodes a growth regulator which inhibits the proliferation of a number of tumor cell lines. It regulates cytokine production, including IL-6, G-CSF and GM-CSF from endothelial cells.
Product Categories/Family for OSM active protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
28,484 Da
NCBI Official Full Name
oncostatin-M preproprotein
NCBI Official Synonym Full Names
oncostatin M
NCBI Official Symbol
OSM
NCBI Protein Information
oncostatin-M
UniProt Protein Name
Oncostatin-M
Protein Family
UniProt Gene Name
OSM
UniProt Synonym Gene Names
OSM
UniProt Entry Name
ONCM_HUMAN

NCBI Description

Oncostatin M is a member of a cytokine family that includes leukemia-inhibitory factor, granulocyte colony-stimulating factor, and interleukin 6. This gene encodes a growth regulator which inhibits the proliferation of a number of tumor cell lines. It regulates cytokine production, including IL-6, G-CSF and GM-CSF from endothelial cells. [provided by RefSeq, Jul 2008]

Uniprot Description

OSM: Growth regulator. Inhibits the proliferation of a number of tumor cell lines. Stimulates proliferation of AIDS-KS cells. It regulates cytokine production, including IL-6, G-CSF and GM-CSF from endothelial cells. Uses both type I OSM receptor (heterodimers composed of LIPR and IL6ST) and type II OSM receptor (heterodimers composed of OSMR and IL6ST). Involved in the maturation of fetal hepatocytes, thereby promoting liver development and regeneration. Belongs to the LIF/OSM family.

Protein type: Secreted; Cytokine; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 22q12.2

Cellular Component: extracellular space

Molecular Function: growth factor activity; oncostatin-M receptor binding; cytokine activity

Biological Process: multicellular organismal development; negative regulation of hormone secretion; tyrosine phosphorylation of Stat3 protein; positive regulation of peptidyl-serine phosphorylation; tyrosine phosphorylation of Stat5 protein; peripheral nervous system development; negative regulation of cell proliferation; cell proliferation; behavioral response to pain; positive regulation of peptidyl-tyrosine phosphorylation; positive regulation of MAPKKK cascade; positive regulation of acute inflammatory response; response to heat; regulation of growth; positive regulation of cell division; positive regulation of cell proliferation; negative regulation of meiosis; tyrosine phosphorylation of Stat1 protein; immune response; positive regulation of transcription from RNA polymerase II promoter

Research Articles on OSM

Similar Products

Product Notes

The OSM osm (Catalog #AAA143730) is an Active Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: AAIGSCSKEY RVLLGQLQKQ TDLMQDTSRL LDPYIRIQGL DVPKLREHCR ERPGAFPSEE TLRGLGRRGF LQTLNATLGC VLHRLADLEQ RLPKAQDLER SGLNIEDLEK LQMARPNILG LRNNIYCMAQ LLDNSDTAEP TKAGRGASQP PTPTPASDAF QRKLEGCRFL HGYHRFMHSV GRVFKWGESP NRSRRHSPHQ ALRKGVRR. It is sometimes possible for the material contained within the vial of "Oncostatin-M, Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.