Differentially expressed in FDCP 6 homolog (DEF6) Recombinant Protein | DEF6 recombinant protein
Recombinant Human Differentially expressed in FDCP 6 homolog (DEF6)
Gene Names
DEF6; IBP; SLAT; SWAP70L
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Differentially expressed in FDCP 6 homolog (DEF6); Recombinant Human Differentially expressed in FDCP 6 homolog (DEF6); DEF6 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-631, Full length protein
Sequence
MALRKELLKSIWYAFTALDVEKSGKVSKSQLKVLSHNLYTVLHIPHDPVALEEHFRDDDDGPVSSQGYMPYLNKYILDKVEEGAFVKEHFDELCWTLTAKKNYRADSNGNSMLSNQDAFRLWCLFNFLSEDKYPLIMVPDEVEYLLKKVLSSMSLEVSLGELEELLAQEAQVAQTTGGLSVWQFLELFNSGRCLRGVGRDTLSMAIHEVYQELIQDVLKQGYLWKRGHLRRNWAERWFQLQPSCLCYFGSEECKEKRGIIPLDAHCCVEVLPDRDGKRCMFCVKTANRTYEMSASDTRQRQEWTAAIQMAIRLQAEGKTSLHKDLKQKRREQREQRERRRAAKEEELLRLQQLQEEKERKLQELELLQEAQRQAERLLQEEEERRRSQHRELQQALEGQLREAEQARASMQAEMELKEEEAARQRQRIKELEEMQQRLQEALQLEVKARRDEESVRIAQTRLLEEEEEKLKQLMQLKEEQERYIERAQQEKEELQQEMAQQSRSLQQAQQQLEEVRQNRQRADEDVEAAQRKLRQASTNVKHWNVQMNRLMHPIEPGDKRPVTSSSFSGFQPPLLAHRDSSLKRLTRWGSQGNRTPSPNSNEQQKSLNGGDEAPAPASTPQEDKLDPAPEN
Sequence Length
631
Species
Human
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
73,910 Da
NCBI Official Full Name
differentially expressed in FDCP 6 homolog
NCBI Official Synonym Full Names
DEF6, guanine nucleotide exchange factor
NCBI Official Symbol
DEF6
NCBI Official Synonym Symbols
IBP; SLAT; SWAP70L
NCBI Protein Information
differentially expressed in FDCP 6 homolog
UniProt Protein Name
Differentially expressed in FDCP 6 homolog
Protein Family
UniProt Gene Name
DEF6
UniProt Synonym Gene Names
IBP; DEF-6
NCBI Description
DEF6, or IBP, is a guanine nucleotide exchange factor (GEF) for RAC (MIM 602048) and CDC42 (MIM 116952) that is highly expressed in B and T cells (Gupta et al., 2003 [PubMed 12923183]).[supplied by OMIM, Mar 2008]
Uniprot Description
Phosphatidylinositol 3,4,5-trisphosphate-dependent guanine nucleotide exchange factor (GEF) which plays a role in the activation of Rho GTPases RAC1, RhoA and CDC42. Can regulate cell morphology in cooperation with activated RAC1. Plays a role in Th2 (T helper cells) development and/or activation, perhaps by interfering with ZAP70 signaling ().
Research Articles on DEF6
Similar Products
Product Notes
The DEF6 def6 (Catalog #AAA1436459) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-631, Full length protein. The amino acid sequence is listed below: MALRKELLKS IWYAFTALDV EKSGKVSKSQ LKVLSHNLYT VLHIPHDPVA LEEHFRDDDD GPVSSQGYMP YLNKYILDKV EEGAFVKEHF DELCWTLTAK KNYRADSNGN SMLSNQDAFR LWCLFNFLSE DKYPLIMVPD EVEYLLKKVL SSMSLEVSLG ELEELLAQEA QVAQTTGGLS VWQFLELFNS GRCLRGVGRD TLSMAIHEVY QELIQDVLKQ GYLWKRGHLR RNWAERWFQL QPSCLCYFGS EECKEKRGII PLDAHCCVEV LPDRDGKRCM FCVKTANRTY EMSASDTRQR QEWTAAIQMA IRLQAEGKTS LHKDLKQKRR EQREQRERRR AAKEEELLRL QQLQEEKERK LQELELLQEA QRQAERLLQE EEERRRSQHR ELQQALEGQL REAEQARASM QAEMELKEEE AARQRQRIKE LEEMQQRLQE ALQLEVKARR DEESVRIAQT RLLEEEEEKL KQLMQLKEEQ ERYIERAQQE KEELQQEMAQ QSRSLQQAQQ QLEEVRQNRQ RADEDVEAAQ RKLRQASTNV KHWNVQMNRL MHPIEPGDKR PVTSSSFSGF QPPLLAHRDS SLKRLTRWGS QGNRTPSPNS NEQQKSLNGG DEAPAPASTP QEDKLDPAPE N. It is sometimes possible for the material contained within the vial of "Differentially expressed in FDCP 6 homolog (DEF6), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
